CCR9 (C-C motif chemokine receptor 9)

Gene

• Entrez ID: 10803
• Gene name: C-C motif chemokine receptor 9
• Gene symbol: CCR9
• Synonyms (NCBI Gene): CC-CKR-9, CDw199, GPR-9-6, GPR28
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: The protein encoded by this gene is a G protein-coupled receptor with seven transmembrane domains that belongs to the beta chemokine receptor family. Chemokines and their receptors are key regulators of thymocyte migration and maturation in normal and inf

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018889	hsa-miR-335-5p	Microarray	18185580
MIRT020973	hsa-miR-155-5p	Proteomics	19193853
MIRT021275	hsa-miR-146a-5p	Microarray	18057241
MIRT873296	hsa-miR-1252	CLIP-seq
MIRT873297	hsa-miR-154	CLIP-seq
MIRT873298	hsa-miR-155	CLIP-seq
MIRT873299	hsa-miR-25	CLIP-seq
MIRT873300	hsa-miR-302f	CLIP-seq
MIRT873301	hsa-miR-31	CLIP-seq
MIRT873302	hsa-miR-3128	CLIP-seq
MIRT873303	hsa-miR-32	CLIP-seq
MIRT873304	hsa-miR-362-5p	CLIP-seq
MIRT873305	hsa-miR-363	CLIP-seq
MIRT873306	hsa-miR-367	CLIP-seq
MIRT873307	hsa-miR-3977	CLIP-seq
MIRT873308	hsa-miR-4420	CLIP-seq
MIRT873309	hsa-miR-4428	CLIP-seq
MIRT873310	hsa-miR-4685-5p	CLIP-seq
MIRT873311	hsa-miR-4696	CLIP-seq
MIRT873312	hsa-miR-4773	CLIP-seq
MIRT873313	hsa-miR-500a	CLIP-seq
MIRT873314	hsa-miR-500b	CLIP-seq
MIRT873315	hsa-miR-548aa	CLIP-seq
MIRT873316	hsa-miR-603	CLIP-seq
MIRT873317	hsa-miR-92a	CLIP-seq
MIRT873318	hsa-miR-92b	CLIP-seq
MIRT1959113	hsa-miR-1227	CLIP-seq
MIRT1959114	hsa-miR-421	CLIP-seq
MIRT1959115	hsa-miR-4252	CLIP-seq
MIRT1959116	hsa-miR-4709-5p	CLIP-seq
MIRT2196044	hsa-miR-15a	CLIP-seq
MIRT2196045	hsa-miR-15b	CLIP-seq
MIRT2196046	hsa-miR-16	CLIP-seq
MIRT2196047	hsa-miR-195	CLIP-seq
MIRT2196048	hsa-miR-3137	CLIP-seq
MIRT2196049	hsa-miR-424	CLIP-seq
MIRT2196050	hsa-miR-4524	CLIP-seq
MIRT2196051	hsa-miR-4676-5p	CLIP-seq
MIRT2196052	hsa-miR-497	CLIP-seq
MIRT2196053	hsa-miR-503	CLIP-seq
MIRT2196054	hsa-miR-575	CLIP-seq
MIRT2196055	hsa-miR-646	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002305	Process	CD8-positive, gamma-delta intraepithelial T cell differentiation	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	TAS	10229797
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10229797
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10640743
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	10229797
GO:0006968	Process	Cellular defense response	TAS	10544196
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10544196
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	10229797
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	18308860
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016493	Function	C-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0060326	Process	Cell chemotaxis	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA

Other IDs

• MIM: 604738
• HGNC: 1610
• e!Ensembl: ENSG00000173585

Protein

• UniProt ID: P51686
• Protein name: C-C chemokine receptor type 9 (C-C CKR-9) (CC-CKR-9) (CCR-9) (G-protein coupled receptor 28) (GPR-9-6) (CD antigen CDw199)
• Protein function: Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level. ; (Microbial infection) Alternative coreceptor with CD4
• PDB: 5LWE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	65 → 317	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the thymus and low in lymph nodes and spleen. {ECO:0000269|PubMed:10229797, ECO:0000269|PubMed:10640743}.
• Sequence:

  MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFI
  VGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCK
  VVNSMYKMNFYSCVLLIMCISVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALC
  IPEILYSQIKEESGIAICTMVYPSDESTKLKSAVLTLKVILGFFLPFVVMACCYTIIIHT
  LIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTIDAYAMFISNCAVSTNIDICFQ
  VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRREGSLKLSSMLL
  ETTSGALSL

• Sequence length: 369

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Intestinal immune network for IgA production

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Bardet-Biedl syndrome 17	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPERSENSITIVITY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	14559839		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	17205512		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	LHGDN	17205512		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26841353		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31432181		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20504763		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20738854	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	16210593		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16210593	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20504763		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30662436		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21344163, 31616626		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21344163	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26168791	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31432181	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20649989, 21637913		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	11487533, 27015091		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	LHGDN	17570212		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	27015091	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33045415	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	15557349, 34633679	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	24936795, 26873648, 30284497, 31712385		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	26873648	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23039882	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26006007		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29020986	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20504763		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11487533, 28147349, 28961803, 29582229		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	23039882	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28961803	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	20491792	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20081876, 30284497, 30375700		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	20081876	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	31801814	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	28327177		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	35115327	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	20397074		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31770615		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	26006007		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23039882	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29582229, 29730559, 30137309, 30662436, 31770615		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	34633679	Stimulate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	31770615		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	14656893, 19567201	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21984373		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17205512, 19567201		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	34633679	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19309748, 32308544	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15147571		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26168791	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35887224	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23640258		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21344163, 31616626		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20649989, 21637913		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15623660, 28903065		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15623660, 25986937, 30008902		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21344163		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	15086554, 18245522, 22433180	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18245518, 18245522		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18245522		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	18245522, 31983065	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	20649989		★☆☆☆☆ Found in Text Mining only
Mucositis	Mucositis	Pubtator	22156200	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30770703		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis Chronic Progressive	Multiple sclerosis	Pubtator	30770703	Inhibit	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	26616645		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	31801814		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31801814		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18245522, 25691296, 29163684, 29666622		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25691296		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28903065		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	20649989		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21637913		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20649989, 21637913	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26003048	Associate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	14559839		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21984373, 23326330, 29434597		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	31100458		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15623660, 28903065		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15623660		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28903065	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20738854, 25248373		★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	31770615		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	28622456		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31733111	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	31733111, 34386009, 35720379, 36505431, 37569326	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	26841353	Associate	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	17181556		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	17181556		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25710912		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24936795, 26457007, 28453759, 29582229		★☆☆☆☆ Found in Text Mining only