VAMP5 (vesicle associated membrane protein 5)

Gene

• Entrez ID: 10791
• Gene name: Vesicle associated membrane protein 5
• Gene symbol: VAMP5
• Synonyms (NCBI Gene): -
• Chromosome: 2
• Chromosome location: 2p11.2
• Summary: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018608	hsa-miR-335-5p	Microarray	18185580
MIRT053373	hsa-miR-9-5p	Microarray, qRT-PCR	23798388
MIRT2144943	hsa-miR-1207-3p	CLIP-seq
MIRT2144944	hsa-miR-205	CLIP-seq
MIRT2144945	hsa-miR-4279	CLIP-seq
MIRT2144946	hsa-miR-4436a	CLIP-seq
MIRT2659143	hsa-miR-1909	CLIP-seq
MIRT2659144	hsa-miR-3147	CLIP-seq
MIRT2659145	hsa-miR-342-5p	CLIP-seq
MIRT2659146	hsa-miR-3680	CLIP-seq
MIRT2659147	hsa-miR-4260	CLIP-seq
MIRT2659148	hsa-miR-4283	CLIP-seq
MIRT2659149	hsa-miR-4425	CLIP-seq
MIRT2659150	hsa-miR-4489	CLIP-seq
MIRT2659151	hsa-miR-4651	CLIP-seq
MIRT2659152	hsa-miR-4664-5p	CLIP-seq
MIRT2659153	hsa-miR-4781-3p	CLIP-seq
MIRT2659154	hsa-miR-608	CLIP-seq
MIRT2659143	hsa-miR-1909	CLIP-seq
MIRT2659144	hsa-miR-3147	CLIP-seq
MIRT2659145	hsa-miR-342-5p	CLIP-seq
MIRT2659146	hsa-miR-3680	CLIP-seq
MIRT2659147	hsa-miR-4260	CLIP-seq
MIRT2659148	hsa-miR-4283	CLIP-seq
MIRT2659149	hsa-miR-4425	CLIP-seq
MIRT2659150	hsa-miR-4489	CLIP-seq
MIRT2659151	hsa-miR-4651	CLIP-seq
MIRT2659152	hsa-miR-4664-5p	CLIP-seq
MIRT2659153	hsa-miR-4781-3p	CLIP-seq
MIRT2659154	hsa-miR-608	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 30833792, 32296183, 33961781
GO:0005770	Component	Late endosome	IEA
GO:0005770	Component	Late endosome	ISS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9725904
GO:0007517	Process	Muscle organ development	IEA
GO:0007517	Process	Muscle organ development	TAS	9725904
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0009986	Component	Cell surface	IDA	21151919
GO:0012505	Component	Endomembrane system	IEA
GO:0014704	Component	Intercalated disc	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	ISS
GO:0031090	Component	Organelle membrane	IEA
GO:0031090	Component	Organelle membrane	ISS
GO:0043001	Process	Golgi to plasma membrane protein transport	IBA
GO:0043001	Process	Golgi to plasma membrane protein transport	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0070062	Component	Extracellular exosome	HDA	20458337

Other IDs

• MIM: 607029
• HGNC: 12646
• e!Ensembl: ENSG00000168899

Protein

• UniProt ID: O95183
• Protein name: Vesicle-associated membrane protein 5 (VAMP-5) (Myobrevin)
• Protein function: May participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00957	Synaptobrevin	4 → 90	Synaptobrevin	Family

• Sequence:

  MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQ
  KKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

• Sequence length: 116

Pathways

KEGG:

SNARE interactions in vesicular transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aganglionosis, Colonic	Colonic Aganglionosis	BEFREE	26970437		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29695640		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29695640	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26970437, 29695640		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	29695640	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33316779	Associate	★☆☆☆☆ Found in Text Mining only