Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10785
Gene name	WDR4 tRNA N7-guanosine methyltransferase non-catalytic subunit
Gene symbol	WDR4
Synonyms (NCBI Gene)	GAMOS6MIGSBTRM82TRMT82WuhohWH
Chromosome	21
Chromosome location	21q22.3
Summary	This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs776760122	->G	Pathogenic, uncertain-significance	Frameshift variant, coding sequence variant, non coding transcript variant
rs779449710	T>C,G	Pathogenic	Intron variant, splice acceptor variant
rs1292041526	C>A,T	Pathogenic	Coding sequence variant, missense variant, intron variant, non coding transcript variant
rs1555976610	T>A,G	Pathogenic, uncertain-significance	Intron variant, non coding transcript variant, missense variant, coding sequence variant
rs1569314907	->GCAGTCCTGGAGCACCC	Pathogenic	Frameshift variant, non coding transcript variant, coding sequence variant

121

Show/Hide all (121)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006119	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	21953056
MIRT006119	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	21953056
MIRT006119	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	21953056
MIRT006119	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	21953056
MIRT006119	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	21953056
MIRT006119	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	21953056
MIRT029098	hsa-miR-26b-5p	Microarray	19088304
MIRT032196	hsa-let-7b-5p	Proteomics	18668040
MIRT051666	hsa-let-7e-5p	CLASH	23622248
MIRT048521	hsa-miR-100-5p	CLASH	23622248
MIRT041960	hsa-miR-484	CLASH	23622248
MIRT039661	hsa-miR-615-3p	CLASH	23622248
MIRT036980	hsa-miR-877-3p	CLASH	23622248
MIRT439289	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439289	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT1490526	hsa-miR-1253	CLIP-seq
MIRT1490527	hsa-miR-146a	CLIP-seq
MIRT1490528	hsa-miR-146b-5p	CLIP-seq
MIRT1490529	hsa-miR-1915	CLIP-seq
MIRT1490530	hsa-miR-203	CLIP-seq
MIRT1490531	hsa-miR-22	CLIP-seq
MIRT1490532	hsa-miR-3125	CLIP-seq
MIRT1490533	hsa-miR-3141	CLIP-seq
MIRT1490534	hsa-miR-3189-5p	CLIP-seq
MIRT1490535	hsa-miR-342-3p	CLIP-seq
MIRT1490536	hsa-miR-362-5p	CLIP-seq
MIRT1490537	hsa-miR-384	CLIP-seq
MIRT1490538	hsa-miR-3916	CLIP-seq
MIRT1490539	hsa-miR-4284	CLIP-seq
MIRT1490540	hsa-miR-4323	CLIP-seq
MIRT1490541	hsa-miR-4476	CLIP-seq
MIRT1490542	hsa-miR-4632	CLIP-seq
MIRT1490543	hsa-miR-4712-3p	CLIP-seq
MIRT1490544	hsa-miR-4768-3p	CLIP-seq
MIRT1490545	hsa-miR-4773	CLIP-seq
MIRT1490546	hsa-miR-4793-5p	CLIP-seq
MIRT1490547	hsa-miR-500b	CLIP-seq
MIRT1490548	hsa-miR-502-5p	CLIP-seq
MIRT1490549	hsa-miR-518d-5p	CLIP-seq
MIRT1490550	hsa-miR-519b-5p	CLIP-seq
MIRT1490551	hsa-miR-519c-5p	CLIP-seq
MIRT1490552	hsa-miR-520c-5p	CLIP-seq
MIRT1490553	hsa-miR-526a	CLIP-seq
MIRT1490554	hsa-miR-543	CLIP-seq
MIRT1490555	hsa-miR-580	CLIP-seq
MIRT1490556	hsa-miR-589	CLIP-seq
MIRT1490557	hsa-miR-628-5p	CLIP-seq
MIRT1490558	hsa-miR-877	CLIP-seq
MIRT1490559	hsa-miR-199a-3p	CLIP-seq
MIRT1490560	hsa-miR-199b-3p	CLIP-seq
MIRT1490561	hsa-miR-2467-3p	CLIP-seq
MIRT1490562	hsa-miR-3129-5p	CLIP-seq
MIRT1490563	hsa-miR-3148	CLIP-seq
MIRT1490564	hsa-miR-4268	CLIP-seq
MIRT1490565	hsa-miR-4448	CLIP-seq
MIRT1490566	hsa-miR-4733-5p	CLIP-seq
MIRT1490567	hsa-miR-4797-3p	CLIP-seq
MIRT1490568	hsa-miR-936	CLIP-seq
MIRT1921052	hsa-miR-1227	CLIP-seq
MIRT1921053	hsa-miR-197	CLIP-seq
MIRT1921054	hsa-miR-4715-3p	CLIP-seq
MIRT1921055	hsa-miR-494	CLIP-seq
MIRT1921052	hsa-miR-1227	CLIP-seq
MIRT1921053	hsa-miR-197	CLIP-seq
MIRT1921054	hsa-miR-4715-3p	CLIP-seq
MIRT1921055	hsa-miR-494	CLIP-seq
MIRT1921052	hsa-miR-1227	CLIP-seq
MIRT1921053	hsa-miR-197	CLIP-seq
MIRT1921054	hsa-miR-4715-3p	CLIP-seq
MIRT1921055	hsa-miR-494	CLIP-seq
MIRT1921052	hsa-miR-1227	CLIP-seq
MIRT1921053	hsa-miR-197	CLIP-seq
MIRT1921054	hsa-miR-4715-3p	CLIP-seq
MIRT1921055	hsa-miR-494	CLIP-seq
MIRT1490561	hsa-miR-2467-3p	CLIP-seq
MIRT2147905	hsa-miR-3545-5p	CLIP-seq
MIRT1490566	hsa-miR-4733-5p	CLIP-seq
MIRT1921052	hsa-miR-1227	CLIP-seq
MIRT2368310	hsa-miR-1237	CLIP-seq
MIRT2368311	hsa-miR-1248	CLIP-seq
MIRT1490526	hsa-miR-1253	CLIP-seq
MIRT2368312	hsa-miR-1305	CLIP-seq
MIRT2368313	hsa-miR-1324	CLIP-seq
MIRT1490527	hsa-miR-146a	CLIP-seq
MIRT1490528	hsa-miR-146b-5p	CLIP-seq
MIRT2368314	hsa-miR-147	CLIP-seq
MIRT1490529	hsa-miR-1915	CLIP-seq
MIRT1921053	hsa-miR-197	CLIP-seq
MIRT1490533	hsa-miR-3141	CLIP-seq
MIRT2368315	hsa-miR-3179	CLIP-seq
MIRT1490534	hsa-miR-3189-5p	CLIP-seq
MIRT1490536	hsa-miR-362-5p	CLIP-seq
MIRT1490537	hsa-miR-384	CLIP-seq
MIRT2368316	hsa-miR-3911	CLIP-seq
MIRT2368317	hsa-miR-421	CLIP-seq
MIRT1490540	hsa-miR-4323	CLIP-seq
MIRT2368318	hsa-miR-4475	CLIP-seq
MIRT1490541	hsa-miR-4476	CLIP-seq
MIRT2368319	hsa-miR-4635	CLIP-seq
MIRT2368320	hsa-miR-4663	CLIP-seq
MIRT2368321	hsa-miR-4709-5p	CLIP-seq
MIRT1490543	hsa-miR-4712-3p	CLIP-seq
MIRT1921054	hsa-miR-4715-3p	CLIP-seq
MIRT1490544	hsa-miR-4768-3p	CLIP-seq
MIRT1490545	hsa-miR-4773	CLIP-seq
MIRT2368322	hsa-miR-4777-5p	CLIP-seq
MIRT1490546	hsa-miR-4793-5p	CLIP-seq
MIRT1490547	hsa-miR-500b	CLIP-seq
MIRT1490549	hsa-miR-518d-5p	CLIP-seq
MIRT1490550	hsa-miR-519b-5p	CLIP-seq
MIRT1490551	hsa-miR-519c-5p	CLIP-seq
MIRT1490552	hsa-miR-520c-5p	CLIP-seq
MIRT1490553	hsa-miR-526a	CLIP-seq
MIRT2368323	hsa-miR-526b	CLIP-seq
MIRT1490554	hsa-miR-543	CLIP-seq
MIRT1490555	hsa-miR-580	CLIP-seq
MIRT1490556	hsa-miR-589	CLIP-seq
MIRT2368324	hsa-miR-644	CLIP-seq
MIRT2368325	hsa-miR-646	CLIP-seq
MIRT1490532	hsa-miR-3125	CLIP-seq
MIRT1490538	hsa-miR-3916	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15861136, 16189514, 25416956, 26751069, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15861136
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	HDA	16780588
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006400	Process	TRNA modification	IBA
GO:0006400	Process	TRNA modification	IDA	15861136
GO:0006974	Process	DNA damage response	IEA
GO:0008033	Process	TRNA processing	IEA
GO:0008047	Function	Enzyme activator activity	IDA	36599982, 36599985, 37369656
GO:0036265	Process	RNA (guanine-N7)-methylation	IEA
GO:0036416	Process	TRNA stabilization	IDA	36599982, 36599985
GO:0043527	Component	TRNA methyltransferase complex	IBA
GO:0043527	Component	TRNA methyltransferase complex	IDA	12403464
GO:0106004	Process	TRNA (guanine-N7)-methylation	IDA	36599982, 36599985, 37369656
GO:0106004	Process	TRNA (guanine-N7)-methylation	IEA
GO:0106143	Component	TRNA (m7G46) methyltransferase complex	IDA	36599982, 36599985
GO:0141106	Function	TRNA methyltransferase activator activity	IDA	36599982, 36599985

MIM	HGNC	e!Ensembl
605924	12756	ENSG00000160193

P57081

Protein name

tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 (Protein Wuho homolog) (hWH) (WD repeat-containing protein 4)

Protein function

Non-catalytic component of the METTL1-WDR4 methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:12403464, PubMed:31031083, PubMed:31031084, Pub

PDB

7U20 , 8CTH , 8CTI , 8D58 , 8D9K , 8D9L , 8EG0 , 8H0N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	178 → 217	WD domain, G-beta repeat	Repeat

Sequence

MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQG
SGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVA
DKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSI
ESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQA
PQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEET
QGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSL
YKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC

Sequence length

412

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Galloway-Mowat syndrome	Likely pathogenic	rs779449710	RCV001254699	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Galloway-Mowat syndrome 6	Likely pathogenic; Pathogenic	rs2517012381, rs776760122, rs1555976610, rs1292041526, rs1569314907, rs779449710	RCV003326685 RCV000758713 RCV000758712 RCV000758710 RCV000758711 RCV000758714 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Microcephaly, growth deficiency, seizures, and brain malformations	Likely pathogenic	rs1021769927	RCV003337928	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLOWAY MOWAT SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WDR4-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aqueductal Stenosis	Aqueductal Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	36733406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26416026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34282052, 36599985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37528384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28691927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract Congenital Nuclear Autosomal Recessive 2	Congenital cataract	Pubtator	36599982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	GENOMICS_ENGLAND_DG	29597095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	37055577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	29983320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30079490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	GENOMICS_ENGLAND_DG	26416026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	29597095, 29983320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35574843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Galloway Mowat syndrome	Galloway-Mowat Syndrome	BEFREE	30079490		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Galloway Mowat syndrome	Galloway-Mowat Syndrome	ORPHANET_DG	30079490		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Galloway Mowat syndrome	Galloway-mowat syndrome	Pubtator	30079490	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Galloway-Mowat syndrome	Galloway-Mowat Syndrome	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Glioma	Glioma	Pubtator	36733406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	30079490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	30079490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemiplegia/hemiparesis	Hemiplegia/hemiparesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hiatal Hernia	Hiatal Hernia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	26416026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30079490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	30079490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28691927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34371184, 37821451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrostomia	Macrostomia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28691927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28617965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	30079490, 36755238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28691927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30079490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	30079490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	37006267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pachygyria	Pachygyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Partial agenesis of corpus callosum	Partial Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism 1	Pituitary dwarfism	Pubtator	26416026, 26429597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PITUITARY DWARFISM I	Pituitary dwarfism	GENOMICS_ENGLAND_DG	26416026		★★★★★ ★☆☆☆☆ Found in Text Mining only
PITUITARY DWARFISM I	Pituitary dwarfism	BEFREE	29597095, 29983320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Profound global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	30079490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	BEFREE	26416026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	GENOMICS_ENGLAND_DG	29597095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seckel syndrome 1	Seckel syndrome	Pubtator	26416026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	31289202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	31289202		★★★★★ ★☆☆☆☆ Found in Text Mining only

WDR4 (WDR4 tRNA N7-guanosine methyltransferase non-catalytic subunit)