Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10783
Gene name	NIMA related kinase 6
Gene symbol	NEK6
Synonyms (NCBI Gene)	SID6-1512
Chromosome	9
Chromosome location	9q33.3
Summary	The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Seve

322

Show/Hide all (322)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002611	hsa-miR-124-3p	Microarray	15685193
MIRT002611	hsa-miR-124-3p	Microarray;Other	15685193
MIRT030523	hsa-miR-24-3p	Microarray	19748357
MIRT049722	hsa-miR-92a-3p	CLASH	23622248
MIRT035813	hsa-miR-1307-3p	CLASH	23622248
MIRT054809	hsa-miR-23a-3p	Luciferase reporter assay	24942805
MIRT438247	gga-miR-26a-5p	Luciferase reporter assay	24795301
MIRT438247	gga-miR-26a-5p	Luciferase reporter assay	24795301
MIRT755414	hsa-miR-26a-5p	Luciferase reporter assayWestern blottingqRT-PCR	37426517
MIRT755956	hsa-miR-323a-3p	Luciferase reporter assayWestern blottingqRT-PCRin vitro cullelar assays	35096064
MIRT1180253	hsa-miR-105	CLIP-seq
MIRT1180254	hsa-miR-185	CLIP-seq
MIRT1180255	hsa-miR-188-5p	CLIP-seq
MIRT1180256	hsa-miR-204	CLIP-seq
MIRT1180257	hsa-miR-205	CLIP-seq
MIRT1180258	hsa-miR-211	CLIP-seq
MIRT1180259	hsa-miR-23a	CLIP-seq
MIRT1180260	hsa-miR-23b	CLIP-seq
MIRT1180261	hsa-miR-23c	CLIP-seq
MIRT1180262	hsa-miR-24	CLIP-seq
MIRT1180263	hsa-miR-3177-5p	CLIP-seq
MIRT1180264	hsa-miR-323-3p	CLIP-seq
MIRT1180265	hsa-miR-3646	CLIP-seq
MIRT1180266	hsa-miR-3671	CLIP-seq
MIRT1180267	hsa-miR-3915	CLIP-seq
MIRT1180268	hsa-miR-3928	CLIP-seq
MIRT1180269	hsa-miR-3934	CLIP-seq
MIRT1180270	hsa-miR-3944-3p	CLIP-seq
MIRT1180271	hsa-miR-4257	CLIP-seq
MIRT1180272	hsa-miR-4306	CLIP-seq
MIRT1180273	hsa-miR-4328	CLIP-seq
MIRT1180274	hsa-miR-4436b-5p	CLIP-seq
MIRT1180275	hsa-miR-4493	CLIP-seq
MIRT1180276	hsa-miR-4503	CLIP-seq
MIRT1180277	hsa-miR-4644	CLIP-seq
MIRT1180278	hsa-miR-4653-3p	CLIP-seq
MIRT1180279	hsa-miR-4656	CLIP-seq
MIRT1180280	hsa-miR-4744	CLIP-seq
MIRT1180281	hsa-miR-4797-5p	CLIP-seq
MIRT1180282	hsa-miR-4802-5p	CLIP-seq
MIRT1180283	hsa-miR-516a-5p	CLIP-seq
MIRT1180284	hsa-miR-552	CLIP-seq
MIRT1180285	hsa-miR-597	CLIP-seq
MIRT1180286	hsa-miR-607	CLIP-seq
MIRT1180287	hsa-miR-617	CLIP-seq
MIRT1180288	hsa-miR-765	CLIP-seq
MIRT1180253	hsa-miR-105	CLIP-seq
MIRT1180289	hsa-miR-1976	CLIP-seq
MIRT1180257	hsa-miR-205	CLIP-seq
MIRT1180259	hsa-miR-23a	CLIP-seq
MIRT1180260	hsa-miR-23b	CLIP-seq
MIRT1180261	hsa-miR-23c	CLIP-seq
MIRT1180290	hsa-miR-340	CLIP-seq
MIRT1180266	hsa-miR-3671	CLIP-seq
MIRT1180271	hsa-miR-4257	CLIP-seq
MIRT1180291	hsa-miR-4474-5p	CLIP-seq
MIRT1180278	hsa-miR-4653-3p	CLIP-seq
MIRT1180292	hsa-miR-4729	CLIP-seq
MIRT1180286	hsa-miR-607	CLIP-seq
MIRT1180288	hsa-miR-765	CLIP-seq
MIRT1556722	hsa-miR-214	CLIP-seq
MIRT1556723	hsa-miR-3619-5p	CLIP-seq
MIRT1556724	hsa-miR-3665	CLIP-seq
MIRT1180269	hsa-miR-3934	CLIP-seq
MIRT1556725	hsa-miR-761	CLIP-seq
MIRT2052140	hsa-miR-10a	CLIP-seq
MIRT2052141	hsa-miR-10b	CLIP-seq
MIRT2052142	hsa-miR-1179	CLIP-seq
MIRT2052143	hsa-miR-1253	CLIP-seq
MIRT2052144	hsa-miR-129-3p	CLIP-seq
MIRT2052145	hsa-miR-1305	CLIP-seq
MIRT2052146	hsa-miR-1324	CLIP-seq
MIRT2052147	hsa-miR-1343	CLIP-seq
MIRT2052148	hsa-miR-198	CLIP-seq
MIRT1556722	hsa-miR-214	CLIP-seq
MIRT1180259	hsa-miR-23a	CLIP-seq
MIRT1180260	hsa-miR-23b	CLIP-seq
MIRT1180261	hsa-miR-23c	CLIP-seq
MIRT2052149	hsa-miR-3120-5p	CLIP-seq
MIRT2052150	hsa-miR-3125	CLIP-seq
MIRT2052151	hsa-miR-3173-3p	CLIP-seq
MIRT2052152	hsa-miR-3202	CLIP-seq
MIRT1180264	hsa-miR-323-3p	CLIP-seq
MIRT2052153	hsa-miR-338-3p	CLIP-seq
MIRT1180290	hsa-miR-340	CLIP-seq
MIRT1556723	hsa-miR-3619-5p	CLIP-seq
MIRT2052154	hsa-miR-3620	CLIP-seq
MIRT1556724	hsa-miR-3665	CLIP-seq
MIRT2052155	hsa-miR-3916	CLIP-seq
MIRT1180269	hsa-miR-3934	CLIP-seq
MIRT2052156	hsa-miR-4276	CLIP-seq
MIRT2052157	hsa-miR-4284	CLIP-seq
MIRT2052158	hsa-miR-4310	CLIP-seq
MIRT2052159	hsa-miR-4315	CLIP-seq
MIRT2052160	hsa-miR-4426	CLIP-seq
MIRT2052161	hsa-miR-4434	CLIP-seq
MIRT2052162	hsa-miR-4435	CLIP-seq
MIRT2052163	hsa-miR-4469	CLIP-seq
MIRT2052164	hsa-miR-4476	CLIP-seq
MIRT2052165	hsa-miR-448	CLIP-seq
MIRT2052166	hsa-miR-4494	CLIP-seq
MIRT2052167	hsa-miR-4516	CLIP-seq
MIRT2052168	hsa-miR-4531	CLIP-seq
MIRT2052169	hsa-miR-4533	CLIP-seq
MIRT2052170	hsa-miR-4637	CLIP-seq
MIRT2052171	hsa-miR-4640-5p	CLIP-seq
MIRT2052172	hsa-miR-4647	CLIP-seq
MIRT1180278	hsa-miR-4653-3p	CLIP-seq
MIRT2052173	hsa-miR-4662b	CLIP-seq
MIRT2052174	hsa-miR-4672	CLIP-seq
MIRT2052175	hsa-miR-4697-3p	CLIP-seq
MIRT2052176	hsa-miR-4726-5p	CLIP-seq
MIRT1180292	hsa-miR-4729	CLIP-seq
MIRT2052177	hsa-miR-4733-5p	CLIP-seq
MIRT2052178	hsa-miR-4738-5p	CLIP-seq
MIRT1180280	hsa-miR-4744	CLIP-seq
MIRT2052179	hsa-miR-4749-3p	CLIP-seq
MIRT2052180	hsa-miR-4768-3p	CLIP-seq
MIRT2052181	hsa-miR-4790-5p	CLIP-seq
MIRT1180281	hsa-miR-4797-5p	CLIP-seq
MIRT1180282	hsa-miR-4802-5p	CLIP-seq
MIRT2052182	hsa-miR-516b	CLIP-seq
MIRT2052183	hsa-miR-545	CLIP-seq
MIRT2052184	hsa-miR-548k	CLIP-seq
MIRT2052185	hsa-miR-548n	CLIP-seq
MIRT1180286	hsa-miR-607	CLIP-seq
MIRT2052186	hsa-miR-663b	CLIP-seq
MIRT2052187	hsa-miR-665	CLIP-seq
MIRT1556725	hsa-miR-761	CLIP-seq
MIRT1180288	hsa-miR-765	CLIP-seq
MIRT2052142	hsa-miR-1179	CLIP-seq
MIRT2281455	hsa-miR-1207-3p	CLIP-seq
MIRT2281456	hsa-miR-1231	CLIP-seq
MIRT2281457	hsa-miR-124	CLIP-seq
MIRT2052143	hsa-miR-1253	CLIP-seq
MIRT2052144	hsa-miR-129-3p	CLIP-seq
MIRT2281458	hsa-miR-1297	CLIP-seq
MIRT2052145	hsa-miR-1305	CLIP-seq
MIRT2052146	hsa-miR-1324	CLIP-seq
MIRT2052147	hsa-miR-1343	CLIP-seq
MIRT2281459	hsa-miR-141	CLIP-seq
MIRT2281460	hsa-miR-142-5p	CLIP-seq
MIRT2281461	hsa-miR-144	CLIP-seq
MIRT2281462	hsa-miR-186	CLIP-seq
MIRT1180255	hsa-miR-188-5p	CLIP-seq
MIRT2281463	hsa-miR-197	CLIP-seq
MIRT1180289	hsa-miR-1976	CLIP-seq
MIRT2281464	hsa-miR-200a	CLIP-seq
MIRT2281465	hsa-miR-203	CLIP-seq
MIRT1180256	hsa-miR-204	CLIP-seq
MIRT1180257	hsa-miR-205	CLIP-seq
MIRT1180258	hsa-miR-211	CLIP-seq
MIRT2281466	hsa-miR-2115	CLIP-seq
MIRT1556722	hsa-miR-214	CLIP-seq
MIRT2281467	hsa-miR-216a	CLIP-seq
MIRT2281468	hsa-miR-216b	CLIP-seq
MIRT2281469	hsa-miR-219-5p	CLIP-seq
MIRT2281470	hsa-miR-224	CLIP-seq
MIRT2281471	hsa-miR-2276	CLIP-seq
MIRT1180259	hsa-miR-23a	CLIP-seq
MIRT1180260	hsa-miR-23b	CLIP-seq
MIRT1180261	hsa-miR-23c	CLIP-seq
MIRT1180262	hsa-miR-24	CLIP-seq
MIRT2281472	hsa-miR-26a	CLIP-seq
MIRT2281473	hsa-miR-26b	CLIP-seq
MIRT2281474	hsa-miR-298	CLIP-seq
MIRT2281475	hsa-miR-3119	CLIP-seq
MIRT2052149	hsa-miR-3120-5p	CLIP-seq
MIRT2281476	hsa-miR-3133	CLIP-seq
MIRT2281477	hsa-miR-3140-5p	CLIP-seq
MIRT2281478	hsa-miR-3161	CLIP-seq
MIRT2052151	hsa-miR-3173-3p	CLIP-seq
MIRT1180263	hsa-miR-3177-5p	CLIP-seq
MIRT2281479	hsa-miR-3179	CLIP-seq
MIRT2281480	hsa-miR-3194-3p	CLIP-seq
MIRT1180264	hsa-miR-323-3p	CLIP-seq
MIRT2281481	hsa-miR-337-5p	CLIP-seq
MIRT2052153	hsa-miR-338-3p	CLIP-seq
MIRT1180290	hsa-miR-340	CLIP-seq
MIRT2281482	hsa-miR-3611	CLIP-seq
MIRT1556723	hsa-miR-3619-5p	CLIP-seq
MIRT1180265	hsa-miR-3646	CLIP-seq
MIRT2281483	hsa-miR-3655	CLIP-seq
MIRT2281484	hsa-miR-3662	CLIP-seq
MIRT1556724	hsa-miR-3665	CLIP-seq
MIRT2281485	hsa-miR-3667-3p	CLIP-seq
MIRT1180266	hsa-miR-3671	CLIP-seq
MIRT2281486	hsa-miR-3673	CLIP-seq
MIRT2281487	hsa-miR-3678-3p	CLIP-seq
MIRT2281488	hsa-miR-3682-3p	CLIP-seq
MIRT2281489	hsa-miR-3685	CLIP-seq
MIRT2281490	hsa-miR-3689d	CLIP-seq
MIRT2281491	hsa-miR-3692	CLIP-seq
MIRT2281492	hsa-miR-3714	CLIP-seq
MIRT2281493	hsa-miR-384	CLIP-seq
MIRT2281494	hsa-miR-3907	CLIP-seq
MIRT2281495	hsa-miR-3910	CLIP-seq
MIRT2281496	hsa-miR-3927	CLIP-seq
MIRT1180269	hsa-miR-3934	CLIP-seq
MIRT2281497	hsa-miR-4256	CLIP-seq
MIRT1180271	hsa-miR-4257	CLIP-seq
MIRT2052156	hsa-miR-4276	CLIP-seq
MIRT2052157	hsa-miR-4284	CLIP-seq
MIRT2281498	hsa-miR-4288	CLIP-seq
MIRT2281499	hsa-miR-4291	CLIP-seq
MIRT2281500	hsa-miR-4297	CLIP-seq
MIRT2052158	hsa-miR-4310	CLIP-seq
MIRT2052159	hsa-miR-4315	CLIP-seq
MIRT1180273	hsa-miR-4328	CLIP-seq
MIRT2052162	hsa-miR-4435	CLIP-seq
MIRT1180274	hsa-miR-4436b-5p	CLIP-seq
MIRT2281501	hsa-miR-4465	CLIP-seq
MIRT2052163	hsa-miR-4469	CLIP-seq
MIRT2052164	hsa-miR-4476	CLIP-seq
MIRT2281502	hsa-miR-4481	CLIP-seq
MIRT1180275	hsa-miR-4493	CLIP-seq
MIRT2052166	hsa-miR-4494	CLIP-seq
MIRT2281503	hsa-miR-4524	CLIP-seq
MIRT2052170	hsa-miR-4637	CLIP-seq
MIRT2052171	hsa-miR-4640-5p	CLIP-seq
MIRT2281504	hsa-miR-4643	CLIP-seq
MIRT1180278	hsa-miR-4653-3p	CLIP-seq
MIRT2281505	hsa-miR-466	CLIP-seq
MIRT2052174	hsa-miR-4672	CLIP-seq
MIRT2052175	hsa-miR-4697-3p	CLIP-seq
MIRT2281506	hsa-miR-4701-5p	CLIP-seq
MIRT2281507	hsa-miR-4709-5p	CLIP-seq
MIRT2281508	hsa-miR-4719	CLIP-seq
MIRT2281509	hsa-miR-4720-3p	CLIP-seq
MIRT2281510	hsa-miR-4724-5p	CLIP-seq
MIRT2052176	hsa-miR-4726-5p	CLIP-seq
MIRT2281511	hsa-miR-4731-3p	CLIP-seq
MIRT2052177	hsa-miR-4733-5p	CLIP-seq
MIRT2052178	hsa-miR-4738-5p	CLIP-seq
MIRT1180280	hsa-miR-4744	CLIP-seq
MIRT2281512	hsa-miR-4745-5p	CLIP-seq
MIRT2052179	hsa-miR-4749-3p	CLIP-seq
MIRT2281513	hsa-miR-4758-5p	CLIP-seq
MIRT2281514	hsa-miR-4778-5p	CLIP-seq
MIRT2281515	hsa-miR-4782-3p	CLIP-seq
MIRT2281516	hsa-miR-4789-3p	CLIP-seq
MIRT2052181	hsa-miR-4790-5p	CLIP-seq
MIRT2281517	hsa-miR-4796-3p	CLIP-seq
MIRT1180281	hsa-miR-4797-5p	CLIP-seq
MIRT2281518	hsa-miR-4801	CLIP-seq
MIRT1180282	hsa-miR-4802-5p	CLIP-seq
MIRT2281519	hsa-miR-4804-3p	CLIP-seq
MIRT2281520	hsa-miR-493	CLIP-seq
MIRT2281521	hsa-miR-506	CLIP-seq
MIRT2281522	hsa-miR-516a-3p	CLIP-seq
MIRT1180283	hsa-miR-516a-5p	CLIP-seq
MIRT2052182	hsa-miR-516b	CLIP-seq
MIRT2281523	hsa-miR-520g	CLIP-seq
MIRT2281524	hsa-miR-520h	CLIP-seq
MIRT2052183	hsa-miR-545	CLIP-seq
MIRT2281525	hsa-miR-548c-3p	CLIP-seq
MIRT2281526	hsa-miR-548g	CLIP-seq
MIRT1180284	hsa-miR-552	CLIP-seq
MIRT2281527	hsa-miR-577	CLIP-seq
MIRT2281528	hsa-miR-588	CLIP-seq
MIRT1180286	hsa-miR-607	CLIP-seq
MIRT1180287	hsa-miR-617	CLIP-seq
MIRT2281529	hsa-miR-632	CLIP-seq
MIRT2281530	hsa-miR-645	CLIP-seq
MIRT2052186	hsa-miR-663b	CLIP-seq
MIRT2281531	hsa-miR-668	CLIP-seq
MIRT2281532	hsa-miR-720	CLIP-seq
MIRT2281533	hsa-miR-758	CLIP-seq
MIRT1556725	hsa-miR-761	CLIP-seq
MIRT1180288	hsa-miR-765	CLIP-seq
MIRT2281534	hsa-miR-938	CLIP-seq
MIRT1180259	hsa-miR-23a	CLIP-seq
MIRT1180260	hsa-miR-23b	CLIP-seq
MIRT1180261	hsa-miR-23c	CLIP-seq
MIRT1180264	hsa-miR-323-3p	CLIP-seq
MIRT1180280	hsa-miR-4744	CLIP-seq
MIRT1180288	hsa-miR-765	CLIP-seq
MIRT2281455	hsa-miR-1207-3p	CLIP-seq
MIRT2579802	hsa-miR-1285	CLIP-seq
MIRT2579803	hsa-miR-1909	CLIP-seq
MIRT2579804	hsa-miR-3117-5p	CLIP-seq
MIRT2579805	hsa-miR-3176	CLIP-seq
MIRT2579806	hsa-miR-3187-5p	CLIP-seq
MIRT2281480	hsa-miR-3194-3p	CLIP-seq
MIRT2579807	hsa-miR-3922-3p	CLIP-seq
MIRT2281499	hsa-miR-4291	CLIP-seq
MIRT2281500	hsa-miR-4297	CLIP-seq
MIRT2052158	hsa-miR-4310	CLIP-seq
MIRT2052162	hsa-miR-4435	CLIP-seq
MIRT2052163	hsa-miR-4469	CLIP-seq
MIRT2579808	hsa-miR-4505	CLIP-seq
MIRT2579809	hsa-miR-4686	CLIP-seq
MIRT2579810	hsa-miR-4718	CLIP-seq
MIRT2052178	hsa-miR-4738-5p	CLIP-seq
MIRT2052179	hsa-miR-4749-3p	CLIP-seq
MIRT2579811	hsa-miR-612	CLIP-seq
MIRT2052186	hsa-miR-663b	CLIP-seq
MIRT2281531	hsa-miR-668	CLIP-seq
MIRT2579812	hsa-miR-764	CLIP-seq
MIRT2281455	hsa-miR-1207-3p	CLIP-seq
MIRT2579802	hsa-miR-1285	CLIP-seq
MIRT2686184	hsa-miR-2110	CLIP-seq
MIRT2686185	hsa-miR-3150a-3p	CLIP-seq
MIRT2579806	hsa-miR-3187-5p	CLIP-seq
MIRT2281480	hsa-miR-3194-3p	CLIP-seq
MIRT1180290	hsa-miR-340	CLIP-seq
MIRT2686186	hsa-miR-370	CLIP-seq
MIRT2686187	hsa-miR-4260	CLIP-seq
MIRT2686188	hsa-miR-4271	CLIP-seq
MIRT2281499	hsa-miR-4291	CLIP-seq
MIRT2281500	hsa-miR-4297	CLIP-seq
MIRT2052158	hsa-miR-4310	CLIP-seq
MIRT2052162	hsa-miR-4435	CLIP-seq
MIRT2052163	hsa-miR-4469	CLIP-seq
MIRT2579808	hsa-miR-4505	CLIP-seq
MIRT2579809	hsa-miR-4686	CLIP-seq
MIRT2579810	hsa-miR-4718	CLIP-seq
MIRT2686189	hsa-miR-4725-3p	CLIP-seq
MIRT2052178	hsa-miR-4738-5p	CLIP-seq
MIRT2052179	hsa-miR-4749-3p	CLIP-seq
MIRT2579811	hsa-miR-612	CLIP-seq
MIRT2052186	hsa-miR-663b	CLIP-seq

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	14563848
GO:0000922	Component	Spindle pole	IEA
GO:0001222	Function	Transcription corepressor binding	IPI	20873783
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	11516946, 14563848, 19001501, 20873783
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16476580, 20873783, 25416956, 28514442, 29892012, 31515488, 32296183, 32707033, 32814053, 33961781
GO:0005524	Function	ATP binding	IDA	14563848
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	12054534
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	12054534
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	20873783
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006468	Process	Protein phosphorylation	IDA	12840024, 31409757
GO:0006915	Process	Apoptotic process	IEA
GO:0007052	Process	Mitotic spindle organization	TAS
GO:0007059	Process	Chromosome segregation	IBA
GO:0007059	Process	Chromosome segregation	IDA	14563848
GO:0007059	Process	Chromosome segregation	IEA
GO:0007077	Process	Mitotic nuclear membrane disassembly	TAS
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	TAS	16280549
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	19001501
GO:0019894	Function	Kinesin binding	IPI	19001501
GO:0019901	Function	Protein kinase binding	IPI	19001501
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IBA
GO:0030071	Process	Regulation of mitotic metaphase/anaphase transition	IDA	14563848
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	20873783
GO:0032991	Component	Protein-containing complex	IDA	20873783
GO:0033044	Process	Regulation of chromosome organization	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0046777	Process	Protein autophosphorylation	IDA	14563848, 20873783
GO:0046872	Function	Metal ion binding	IEA
GO:0051225	Process	Spindle assembly	IEA
GO:0051225	Process	Spindle assembly	TAS	21200151
GO:0051301	Process	Cell division	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	20873783
GO:2000772	Process	Regulation of cellular senescence	TAS	21200151

MIM	HGNC	e!Ensembl
604884	7749	ENSG00000119408

Q9HC98

Protein name

Serine/threonine-protein kinase Nek6 (EC 2.7.11.34) (Never in mitosis A-related kinase 6) (NimA-related protein kinase 6) (Protein kinase SID6-1512)

Protein function

Protein kinase which plays an important role in mitotic cell cycle progression (PubMed:11516946, PubMed:14563848). Required for chromosome segregation at metaphase-anaphase transition, robust mitotic spindle formation and cytokinesis (PubMed:194

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	45 → 308	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous, with highest expression in heart and skeletal muscle. {ECO:0000269|PubMed:12054534}.

Sequence

MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVY
KATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNI
VLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFI
TATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEM
AALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVH
QVAKQMHIWMSST

Sequence length

313

Interactions

View interactions

	Reactome
			Activation of NIMA Kinases NEK9, NEK6, NEK7 Nuclear Pore Complex (NPC) Disassembly EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RHINOSINUSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF PHARYNX	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONSILLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER RESPIRATORY TRACT DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28329684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30153958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18827816, 21725899, 25523445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21725899, 25523445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	33639936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	26423403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26423403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	7726160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	25523445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	36189312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16476580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21725899, 25523445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30153958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27899381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20407017, 21725899, 28720575, 30153958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	7657592, 7726160, 8285579, 8499920		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	7726160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20407017, 20595392, 30153958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	15622488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27899381		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	36672191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33639936	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30080301, 31123409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35898455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	18827816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36958462	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30207869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26259750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	GWASCAT_DG	27723757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

NEK6 (NIMA related kinase 6)