Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10758
Gene name	TRAF3 interacting protein 2
Gene symbol	TRAF3IP2
Synonyms (NCBI Gene)	ACT1C6orf2C6orf4C6orf5C6orf6CANDF8CIKSPSORS13
Chromosome	6
Chromosome location	6q21
Summary	This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gen

300

Show/Hide all (300)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027633	hsa-miR-98-5p	Microarray	19088304
MIRT698080	hsa-miR-6872-3p	HITS-CLIP	23313552
MIRT698079	hsa-miR-8064	HITS-CLIP	23313552
MIRT686546	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT686545	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT686544	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT686543	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT686542	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT686541	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT686540	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT686539	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT686538	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT686537	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT686536	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT686535	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT686534	hsa-miR-302e	HITS-CLIP	23313552
MIRT686533	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT686532	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT686531	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT686530	hsa-miR-520b	HITS-CLIP	23313552
MIRT686529	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT686528	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT686527	hsa-miR-520e	HITS-CLIP	23313552
MIRT686526	hsa-miR-4438	HITS-CLIP	23313552
MIRT686525	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT686524	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT686523	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT686522	hsa-miR-520h	HITS-CLIP	23313552
MIRT686521	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT686520	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT686519	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT686518	hsa-miR-1253	HITS-CLIP	23313552
MIRT686517	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT686516	hsa-miR-3145-3p	HITS-CLIP	23313552
MIRT686515	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT686514	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT686513	hsa-miR-5095	HITS-CLIP	23313552
MIRT686512	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT686511	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT631573	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT631572	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT631571	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT631570	hsa-miR-4284	HITS-CLIP	23824327
MIRT631569	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT631568	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT631567	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT631566	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT631565	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT631564	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT631563	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT631562	hsa-miR-7977	HITS-CLIP	23824327
MIRT631561	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT631560	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT631559	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT631558	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT631557	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT631556	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT631555	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT631554	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT631553	hsa-miR-3689c	HITS-CLIP	23824327
MIRT631552	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT631551	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT631550	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT631549	hsa-miR-3122	HITS-CLIP	23824327
MIRT631548	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT631547	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT631546	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT631545	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT528704	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT528703	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT528702	hsa-miR-6812-3p	PAR-CLIP	20371350
MIRT528701	hsa-miR-150-5p	PAR-CLIP	20371350
MIRT528700	hsa-miR-532-3p	PAR-CLIP	20371350
MIRT569417	hsa-miR-2116-3p	PAR-CLIP	20371350
MIRT528699	hsa-miR-3120-5p	PAR-CLIP	20371350
MIRT528696	hsa-miR-4713-5p	PAR-CLIP	20371350
MIRT528695	hsa-miR-6888-3p	PAR-CLIP	20371350
MIRT516387	hsa-miR-6858-3p	PAR-CLIP	21572407
MIRT516386	hsa-miR-4676-5p	PAR-CLIP	21572407
MIRT516385	hsa-miR-575	PAR-CLIP	21572407
MIRT516383	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT516382	hsa-miR-1273f	PAR-CLIP	21572407
MIRT516381	hsa-miR-4534	PAR-CLIP	21572407
MIRT516380	hsa-miR-8082	PAR-CLIP	21572407
MIRT516379	hsa-miR-4653-3p	PAR-CLIP	21572407
MIRT516377	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT516376	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT516374	hsa-miR-5096	PAR-CLIP	21572407
MIRT528704	hsa-miR-5586-3p	PAR-CLIP	22012620
MIRT528703	hsa-miR-6814-5p	PAR-CLIP	22012620
MIRT528702	hsa-miR-6812-3p	PAR-CLIP	22012620
MIRT528701	hsa-miR-150-5p	PAR-CLIP	22012620
MIRT528700	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT528699	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT528698	hsa-miR-6499-3p	PAR-CLIP	22012620
MIRT528697	hsa-miR-143-5p	PAR-CLIP	22012620
MIRT528696	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT528695	hsa-miR-6888-3p	PAR-CLIP	22012620
MIRT516387	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT516386	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT516385	hsa-miR-575	PAR-CLIP	23446348
MIRT516384	hsa-miR-2392	PAR-CLIP	23446348
MIRT516375	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516383	hsa-miR-6514-5p	PAR-CLIP	23446348
MIRT516382	hsa-miR-1273f	PAR-CLIP	23446348
MIRT516381	hsa-miR-4534	PAR-CLIP	23446348
MIRT516380	hsa-miR-8082	PAR-CLIP	23446348
MIRT516379	hsa-miR-4653-3p	PAR-CLIP	23446348
MIRT516378	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT516377	hsa-miR-3152-3p	PAR-CLIP	23446348
MIRT516376	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT516375	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516374	hsa-miR-5096	PAR-CLIP	23446348
MIRT698080	hsa-miR-6872-3p	HITS-CLIP	23313552
MIRT698079	hsa-miR-8064	HITS-CLIP	23313552
MIRT686546	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT686545	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT686544	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT686543	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT686542	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT686541	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT686540	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT686539	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT686538	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT686537	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT686536	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT686535	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT686534	hsa-miR-302e	HITS-CLIP	23313552
MIRT686533	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT686532	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT686531	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT686530	hsa-miR-520b	HITS-CLIP	23313552
MIRT686529	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT686528	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT686527	hsa-miR-520e	HITS-CLIP	23313552
MIRT686526	hsa-miR-4438	HITS-CLIP	23313552
MIRT686525	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT686524	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT686523	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT686522	hsa-miR-520h	HITS-CLIP	23313552
MIRT686521	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT686520	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT686519	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT686518	hsa-miR-1253	HITS-CLIP	23313552
MIRT686517	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT686516	hsa-miR-3145-3p	HITS-CLIP	23313552
MIRT686515	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT686514	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT686513	hsa-miR-5095	HITS-CLIP	23313552
MIRT686512	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT686511	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT631573	hsa-miR-214-5p	HITS-CLIP	23824327
MIRT631572	hsa-miR-6811-3p	HITS-CLIP	23824327
MIRT631571	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT631570	hsa-miR-4284	HITS-CLIP	23824327
MIRT631569	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT631568	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT631567	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT631566	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT631565	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT631564	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT631563	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT631562	hsa-miR-7977	HITS-CLIP	23824327
MIRT631561	hsa-miR-6514-3p	HITS-CLIP	23824327
MIRT631560	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT631559	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT631558	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT631557	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT631556	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT631555	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT631554	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT631553	hsa-miR-3689c	HITS-CLIP	23824327
MIRT631552	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT631551	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT631550	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT631549	hsa-miR-3122	HITS-CLIP	23824327
MIRT631548	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT631547	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT631546	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT631545	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT528704	hsa-miR-5586-3p	PAR-CLIP	20371350
MIRT528703	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT528702	hsa-miR-6812-3p	PAR-CLIP	20371350
MIRT528701	hsa-miR-150-5p	PAR-CLIP	20371350
MIRT528700	hsa-miR-532-3p	PAR-CLIP	20371350
MIRT569417	hsa-miR-2116-3p	PAR-CLIP	20371350
MIRT528699	hsa-miR-3120-5p	PAR-CLIP	20371350
MIRT528696	hsa-miR-4713-5p	PAR-CLIP	20371350
MIRT528695	hsa-miR-6888-3p	PAR-CLIP	20371350
MIRT516387	hsa-miR-6858-3p	PAR-CLIP	21572407
MIRT516386	hsa-miR-4676-5p	PAR-CLIP	21572407
MIRT516385	hsa-miR-575	PAR-CLIP	21572407
MIRT516383	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT516382	hsa-miR-1273f	PAR-CLIP	21572407
MIRT516381	hsa-miR-4534	PAR-CLIP	21572407
MIRT516380	hsa-miR-8082	PAR-CLIP	21572407
MIRT516379	hsa-miR-4653-3p	PAR-CLIP	21572407
MIRT516377	hsa-miR-3152-3p	PAR-CLIP	21572407
MIRT516376	hsa-miR-4662a-5p	PAR-CLIP	21572407
MIRT516374	hsa-miR-5096	PAR-CLIP	21572407
MIRT528704	hsa-miR-5586-3p	PAR-CLIP	22012620
MIRT528703	hsa-miR-6814-5p	PAR-CLIP	22012620
MIRT528702	hsa-miR-6812-3p	PAR-CLIP	22012620
MIRT528701	hsa-miR-150-5p	PAR-CLIP	22012620
MIRT528700	hsa-miR-532-3p	PAR-CLIP	22012620
MIRT528699	hsa-miR-3120-5p	PAR-CLIP	22012620
MIRT528698	hsa-miR-6499-3p	PAR-CLIP	22012620
MIRT528697	hsa-miR-143-5p	PAR-CLIP	22012620
MIRT528696	hsa-miR-4713-5p	PAR-CLIP	22012620
MIRT528695	hsa-miR-6888-3p	PAR-CLIP	22012620
MIRT516387	hsa-miR-6858-3p	PAR-CLIP	23446348
MIRT516386	hsa-miR-4676-5p	PAR-CLIP	23446348
MIRT516385	hsa-miR-575	PAR-CLIP	23446348
MIRT516384	hsa-miR-2392	PAR-CLIP	23446348
MIRT516375	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516383	hsa-miR-6514-5p	PAR-CLIP	23446348
MIRT516382	hsa-miR-1273f	PAR-CLIP	23446348
MIRT516381	hsa-miR-4534	PAR-CLIP	23446348
MIRT516380	hsa-miR-8082	PAR-CLIP	23446348
MIRT516379	hsa-miR-4653-3p	PAR-CLIP	23446348
MIRT516378	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT516377	hsa-miR-3152-3p	PAR-CLIP	23446348
MIRT516376	hsa-miR-4662a-5p	PAR-CLIP	23446348
MIRT516375	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT516374	hsa-miR-5096	PAR-CLIP	23446348
MIRT1450954	hsa-miR-1185	CLIP-seq
MIRT1450955	hsa-miR-133a	CLIP-seq
MIRT1450956	hsa-miR-133b	CLIP-seq
MIRT1450957	hsa-miR-3605-5p	CLIP-seq
MIRT1450958	hsa-miR-3679-5p	CLIP-seq
MIRT1450959	hsa-miR-4328	CLIP-seq
MIRT1450960	hsa-miR-4527	CLIP-seq
MIRT1450961	hsa-miR-4649-3p	CLIP-seq
MIRT1450962	hsa-miR-4731-3p	CLIP-seq
MIRT1450963	hsa-miR-4801	CLIP-seq
MIRT1450964	hsa-miR-1343	CLIP-seq
MIRT1450965	hsa-miR-3074-5p	CLIP-seq
MIRT1450966	hsa-miR-323-3p	CLIP-seq
MIRT1450967	hsa-miR-4488	CLIP-seq
MIRT1450968	hsa-miR-4639-5p	CLIP-seq
MIRT1450969	hsa-miR-4640-5p	CLIP-seq
MIRT1450970	hsa-miR-4697-5p	CLIP-seq
MIRT1450971	hsa-miR-4726-5p	CLIP-seq
MIRT1450972	hsa-miR-637	CLIP-seq
MIRT2134790	hsa-miR-188-5p	CLIP-seq
MIRT2134791	hsa-miR-3064-3p	CLIP-seq
MIRT1450966	hsa-miR-323-3p	CLIP-seq
MIRT1450968	hsa-miR-4639-5p	CLIP-seq
MIRT2134792	hsa-miR-548g	CLIP-seq
MIRT2134793	hsa-miR-642b	CLIP-seq
MIRT1450964	hsa-miR-1343	CLIP-seq
MIRT2649538	hsa-miR-147	CLIP-seq
MIRT2134790	hsa-miR-188-5p	CLIP-seq
MIRT2649539	hsa-miR-2278	CLIP-seq
MIRT2649540	hsa-miR-2467-3p	CLIP-seq
MIRT2134791	hsa-miR-3064-3p	CLIP-seq
MIRT1450965	hsa-miR-3074-5p	CLIP-seq
MIRT2649541	hsa-miR-3123	CLIP-seq
MIRT2649542	hsa-miR-3130-3p	CLIP-seq
MIRT2649543	hsa-miR-3194-3p	CLIP-seq
MIRT1450966	hsa-miR-323-3p	CLIP-seq
MIRT2649544	hsa-miR-330-3p	CLIP-seq
MIRT2649545	hsa-miR-3615	CLIP-seq
MIRT2649546	hsa-miR-3650	CLIP-seq
MIRT2649547	hsa-miR-3659	CLIP-seq
MIRT2649548	hsa-miR-3674	CLIP-seq
MIRT2649549	hsa-miR-3678-3p	CLIP-seq
MIRT2649550	hsa-miR-3689d	CLIP-seq
MIRT2649551	hsa-miR-3911	CLIP-seq
MIRT2649552	hsa-miR-3919	CLIP-seq
MIRT2649553	hsa-miR-3928	CLIP-seq
MIRT2649554	hsa-miR-4271	CLIP-seq
MIRT2649555	hsa-miR-4274	CLIP-seq
MIRT2649556	hsa-miR-4433	CLIP-seq
MIRT2649557	hsa-miR-4436b-5p	CLIP-seq
MIRT2649558	hsa-miR-4455	CLIP-seq
MIRT2649559	hsa-miR-4459	CLIP-seq
MIRT1450967	hsa-miR-4488	CLIP-seq
MIRT2649560	hsa-miR-4512	CLIP-seq
MIRT1450968	hsa-miR-4639-5p	CLIP-seq
MIRT1450969	hsa-miR-4640-5p	CLIP-seq
MIRT2649561	hsa-miR-4693-3p	CLIP-seq
MIRT1450970	hsa-miR-4697-5p	CLIP-seq
MIRT2649562	hsa-miR-4725-3p	CLIP-seq
MIRT1450971	hsa-miR-4726-5p	CLIP-seq
MIRT2649563	hsa-miR-4757-5p	CLIP-seq
MIRT2649564	hsa-miR-4768-3p	CLIP-seq
MIRT2649565	hsa-miR-4793-3p	CLIP-seq
MIRT2649566	hsa-miR-542-5p	CLIP-seq
MIRT2649567	hsa-miR-548aa	CLIP-seq
MIRT2649568	hsa-miR-548ac	CLIP-seq
MIRT2649569	hsa-miR-548d-3p	CLIP-seq
MIRT2134792	hsa-miR-548g	CLIP-seq
MIRT2649570	hsa-miR-548z	CLIP-seq
MIRT2649571	hsa-miR-587	CLIP-seq
MIRT1450972	hsa-miR-637	CLIP-seq
MIRT2134793	hsa-miR-642b	CLIP-seq
MIRT2649572	hsa-miR-644	CLIP-seq
MIRT2649573	hsa-miR-665	CLIP-seq
MIRT2649557	hsa-miR-4436b-5p	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0001768	Process	Establishment of T cell polarity	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001783	Process	B cell apoptotic process	IEA
GO:0001822	Process	Kidney development	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	23066157
GO:0002269	Process	Leukocyte activation involved in inflammatory response	IEA
GO:0002334	Process	Transitional two stage B cell differentiation	IEA
GO:0002344	Process	B cell affinity maturation	IEA
GO:0002447	Process	Eosinophil mediated immunity	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	12459498, 21516116, 24120361, 25416956
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IC	20554964
GO:0005737	Component	Cytoplasm	IEA
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006954	Process	Inflammatory response	IDA	17277779
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0006959	Process	Humoral immune response	IBA
GO:0006959	Process	Humoral immune response	IEA
GO:0007507	Process	Heart development	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019724	Process	B cell mediated immunity	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IEA
GO:0023035	Process	CD40 signaling pathway	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IC	20554964
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	10962033
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	31376257, 35183823
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IDA	17277779, 19825828
GO:0038173	Process	Interleukin-17A-mediated signaling pathway	IEA
GO:0042092	Process	Type 2 immune response	IEA
GO:0042110	Process	T cell activation	IEA
GO:0042119	Process	Neutrophil activation	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043588	Process	Skin development	IEA
GO:0048255	Process	MRNA stabilization	IEA
GO:0048535	Process	Lymph node development	IEA
GO:0048536	Process	Spleen development	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	19825828
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0070254	Process	Mucus secretion	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	19825828
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0072538	Process	T-helper 17 type immune response	IEA
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IMP	19825828, 24120361
GO:0110012	Process	Protein localization to P-body	IEA
GO:1903882	Process	Negative regulation of interleukin-17-mediated signaling pathway	IDA	23042150
GO:1990959	Process	Eosinophil homeostasis	IEA

MIM	HGNC	e!Ensembl
607043	1343	ENSG00000056972

O43734

Protein name

E3 ubiquitin ligase TRAF3IP2 (EC 2.3.2.27) (Adapter protein CIKS) (Connection to IKK and SAPK/JNK) (E3 ubiquitin-protein ligase CIKS) (Nuclear factor NF-kappa-B activator 1) (ACT1) (TRAF3-interacting protein 2)

Protein function

E3 ubiquitin ligase that catalyzes 'Lys-63'-linked polyubiquitination of target protein, enhancing protein-protein interaction and cell signaling (PubMed:19825828). Transfers ubiquitin from E2 ubiquitin-conjugating enzyme UBE2V1-UBE2N to substra

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08357	SEFIR	410 → 552	SEFIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPT
MLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCS
AVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSL
GGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPL
RSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
PALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNR
AGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDT
AMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVE
GAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYS
WPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL

Sequence length

574

Interactions

View interactions

	KEGG
	Cellular senescence IL-17 signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Candidiasis, familial, 8	Pathogenic; Likely pathogenic	rs1796107143, rs2128374357, rs1795637153, rs375800644, rs557983485, rs1304629512, rs1394840448, rs2536181585, rs1321899075, rs2536179287, rs1583225922, rs397518485	RCV001339332 RCV001362447 RCV003086545 RCV002610544 RCV003106690 View all (7 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Discoid lupus erythematosus	Pathogenic	rs1583223171	RCV001002673	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melanoma	Likely pathogenic	rs375800644	RCV005930531	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (25)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis 13, susceptibility to	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS VULGARIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIATIC ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRAF3IP2-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (87)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	22513979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	22753406	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	21288906	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23085260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	20953186, 20953188, 22298274, 22513239, 25775161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21749686, 23862741, 25014791, 28107378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	20953186, 20953188, 22513239, 22532288, 23116200, 23836313, 25775161		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	GWASDB_DG	20953186		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	GWASCAT_DG	20953186, 26626624, 30552173		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis, Psoriatic	Psoriatic Arthritis	CTD_human_DG	20953186, 20953188		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	23085260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	24561578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23116200, 24416204, 30528823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24416204, 30528823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	24416204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	24416204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25881004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	31292894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	24120361, 31292894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	24892823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36344648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33741027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29430728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cheilitis	Cheilitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	20652909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22445837, 26558270, 31265730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26558270, 26937622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	16690605, 19419963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	23202271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	33825088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23085260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22344559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	19155512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30038719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30038719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28283885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	19419963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	39281206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27660002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	31862399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22445837, 26937622, 29788260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	26192919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26937622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	23202271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Interleukin 2 Receptor Alpha Deficiency of	Interleukin 2 receptor deficiency	Pubtator	24120361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22445837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30021197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	28649782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	7949419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	7949419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21886837, 38360126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23836313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	7949419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroglossia	Macroglossia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12163033, 28283885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	30214271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29430728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28053087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	24892823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	24892823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30038719, 30578323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	19155512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	32602654	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pericarditis	Pericarditis	BEFREE	23836313, 27879428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	20953186, 20953188, 22445837, 22581863, 23202271, 23836313, 23897274, 24005976, 25024377, 25775161, 28274739, 28390815, 29302052, 30076642, 30528823, 31156649, 31230639 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	20953186, 20953188, 20953190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	20953186, 20953188, 22298274, 22513239, 24120361, 25024377, 25775161, 30528823	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASDB_DG	20953188, 23143594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	20953188, 23143594, 25903422		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	20953186, 20953188, 22513239		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis vulgaris	Psoriasis vulgaris	GWASCAT_DG	26626624		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	19155512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	20953186, 20953188, 20953190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	22445837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23862741, 25014791, 28107378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwartz-Jampel Syndrome	Schwartz-Jampel Syndrome	BEFREE	25775161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30635251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30882006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	31074012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	25775161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21448149, 22223479, 29925913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	24416204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic syndrome	Pubtator	24416204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	23085260, 28971844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23541442, 24561578, 31074012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRAF3IP2 (TRAF3 interacting protein 2)