Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10755
Gene name	GIPC PDZ domain containing family member 1
Gene symbol	GIPC1
Synonyms (NCBI Gene)	C19orf3GIPCGLUT1CBPHs.6454IIP-1NIPOPDM2RGS19IP1SEMCAPSYNECTIINSYNECTINTIP-2
Chromosome	19
Chromosome location	19p13.12
Summary	GIPC1 is a scaffolding protein that regulates cell surface receptor expression and trafficking (Lee et al., 2008 [PubMed 18775991]).[supplied by OMIM, Apr 2009]

220

Show/Hide all (220)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040897	hsa-miR-18a-3p	CLASH	23622248
MIRT614987	hsa-miR-1470	HITS-CLIP	23824327
MIRT614986	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT614985	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614984	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT614983	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT614982	hsa-miR-4469	HITS-CLIP	23824327
MIRT614981	hsa-miR-1976	HITS-CLIP	23824327
MIRT614987	hsa-miR-1470	HITS-CLIP	23824327
MIRT614986	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT614985	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614984	hsa-miR-370-3p	HITS-CLIP	23824327
MIRT614983	hsa-miR-6893-3p	HITS-CLIP	23824327
MIRT614982	hsa-miR-4469	HITS-CLIP	23824327
MIRT614981	hsa-miR-1976	HITS-CLIP	23824327
MIRT1019357	hsa-let-7a	CLIP-seq
MIRT1019358	hsa-let-7b	CLIP-seq
MIRT1019359	hsa-let-7c	CLIP-seq
MIRT1019360	hsa-let-7d	CLIP-seq
MIRT1019361	hsa-let-7e	CLIP-seq
MIRT1019362	hsa-let-7f	CLIP-seq
MIRT1019363	hsa-let-7g	CLIP-seq
MIRT1019364	hsa-let-7i	CLIP-seq
MIRT1019365	hsa-miR-105	CLIP-seq
MIRT1019366	hsa-miR-1266	CLIP-seq
MIRT1019367	hsa-miR-1280	CLIP-seq
MIRT1019368	hsa-miR-1285	CLIP-seq
MIRT1019369	hsa-miR-137	CLIP-seq
MIRT1019370	hsa-miR-187	CLIP-seq
MIRT1019371	hsa-miR-1908	CLIP-seq
MIRT1019372	hsa-miR-194	CLIP-seq
MIRT1019373	hsa-miR-202	CLIP-seq
MIRT1019374	hsa-miR-2110	CLIP-seq
MIRT1019375	hsa-miR-25	CLIP-seq
MIRT1019376	hsa-miR-27a	CLIP-seq
MIRT1019377	hsa-miR-27b	CLIP-seq
MIRT1019378	hsa-miR-3155	CLIP-seq
MIRT1019379	hsa-miR-3155b	CLIP-seq
MIRT1019380	hsa-miR-3183	CLIP-seq
MIRT1019381	hsa-miR-3187-5p	CLIP-seq
MIRT1019382	hsa-miR-3194-3p	CLIP-seq
MIRT1019383	hsa-miR-32	CLIP-seq
MIRT1019384	hsa-miR-326	CLIP-seq
MIRT1019385	hsa-miR-330-5p	CLIP-seq
MIRT1019386	hsa-miR-33a	CLIP-seq
MIRT1019387	hsa-miR-33b	CLIP-seq
MIRT1019388	hsa-miR-3612	CLIP-seq
MIRT1019389	hsa-miR-3616-3p	CLIP-seq
MIRT1019390	hsa-miR-363	CLIP-seq
MIRT1019391	hsa-miR-3664-3p	CLIP-seq
MIRT1019392	hsa-miR-367	CLIP-seq
MIRT1019393	hsa-miR-370	CLIP-seq
MIRT1019394	hsa-miR-378g	CLIP-seq
MIRT1019395	hsa-miR-3942-3p	CLIP-seq
MIRT1019396	hsa-miR-3974	CLIP-seq
MIRT1019397	hsa-miR-4268	CLIP-seq
MIRT1019398	hsa-miR-4271	CLIP-seq
MIRT1019399	hsa-miR-4283	CLIP-seq
MIRT1019400	hsa-miR-4433	CLIP-seq
MIRT1019401	hsa-miR-4443	CLIP-seq
MIRT1019402	hsa-miR-4458	CLIP-seq
MIRT1019403	hsa-miR-4459	CLIP-seq
MIRT1019404	hsa-miR-4476	CLIP-seq
MIRT1019405	hsa-miR-4486	CLIP-seq
MIRT1019406	hsa-miR-4500	CLIP-seq
MIRT1019407	hsa-miR-4518	CLIP-seq
MIRT1019408	hsa-miR-4632	CLIP-seq
MIRT1019409	hsa-miR-4640-5p	CLIP-seq
MIRT1019410	hsa-miR-4651	CLIP-seq
MIRT1019411	hsa-miR-4710	CLIP-seq
MIRT1019412	hsa-miR-4721	CLIP-seq
MIRT1019413	hsa-miR-4723-3p	CLIP-seq
MIRT1019414	hsa-miR-4725-3p	CLIP-seq
MIRT1019415	hsa-miR-4726-5p	CLIP-seq
MIRT1019416	hsa-miR-4761-3p	CLIP-seq
MIRT1019417	hsa-miR-4768-3p	CLIP-seq
MIRT1019418	hsa-miR-4779	CLIP-seq
MIRT1019419	hsa-miR-4787-5p	CLIP-seq
MIRT1019420	hsa-miR-484	CLIP-seq
MIRT1019421	hsa-miR-493	CLIP-seq
MIRT1019422	hsa-miR-548ac	CLIP-seq
MIRT1019423	hsa-miR-548d-3p	CLIP-seq
MIRT1019424	hsa-miR-548z	CLIP-seq
MIRT1019425	hsa-miR-550a	CLIP-seq
MIRT1019426	hsa-miR-608	CLIP-seq
MIRT1019427	hsa-miR-612	CLIP-seq
MIRT1019428	hsa-miR-650	CLIP-seq
MIRT1019429	hsa-miR-663	CLIP-seq
MIRT1019430	hsa-miR-744	CLIP-seq
MIRT1019431	hsa-miR-92a	CLIP-seq
MIRT1019432	hsa-miR-92b	CLIP-seq
MIRT1019433	hsa-miR-98	CLIP-seq
MIRT1019396	hsa-miR-3974	CLIP-seq
MIRT1019404	hsa-miR-4476	CLIP-seq
MIRT1019421	hsa-miR-493	CLIP-seq
MIRT1019357	hsa-let-7a	CLIP-seq
MIRT1019358	hsa-let-7b	CLIP-seq
MIRT1019359	hsa-let-7c	CLIP-seq
MIRT1019360	hsa-let-7d	CLIP-seq
MIRT1019361	hsa-let-7e	CLIP-seq
MIRT1019362	hsa-let-7f	CLIP-seq
MIRT1019363	hsa-let-7g	CLIP-seq
MIRT1019364	hsa-let-7i	CLIP-seq
MIRT1019365	hsa-miR-105	CLIP-seq
MIRT1019367	hsa-miR-1280	CLIP-seq
MIRT1019368	hsa-miR-1285	CLIP-seq
MIRT1019370	hsa-miR-187	CLIP-seq
MIRT1019372	hsa-miR-194	CLIP-seq
MIRT1019373	hsa-miR-202	CLIP-seq
MIRT1019374	hsa-miR-2110	CLIP-seq
MIRT1019378	hsa-miR-3155	CLIP-seq
MIRT1019379	hsa-miR-3155b	CLIP-seq
MIRT1019381	hsa-miR-3187-5p	CLIP-seq
MIRT1019382	hsa-miR-3194-3p	CLIP-seq
MIRT1019384	hsa-miR-326	CLIP-seq
MIRT1019385	hsa-miR-330-5p	CLIP-seq
MIRT1019393	hsa-miR-370	CLIP-seq
MIRT1019394	hsa-miR-378g	CLIP-seq
MIRT1019395	hsa-miR-3942-3p	CLIP-seq
MIRT1019398	hsa-miR-4271	CLIP-seq
MIRT1019402	hsa-miR-4458	CLIP-seq
MIRT1019405	hsa-miR-4486	CLIP-seq
MIRT1019406	hsa-miR-4500	CLIP-seq
MIRT1019409	hsa-miR-4640-5p	CLIP-seq
MIRT1019414	hsa-miR-4725-3p	CLIP-seq
MIRT1019415	hsa-miR-4726-5p	CLIP-seq
MIRT1019420	hsa-miR-484	CLIP-seq
MIRT1019422	hsa-miR-548ac	CLIP-seq
MIRT1019423	hsa-miR-548d-3p	CLIP-seq
MIRT1019424	hsa-miR-548z	CLIP-seq
MIRT1019427	hsa-miR-612	CLIP-seq
MIRT1019433	hsa-miR-98	CLIP-seq
MIRT2234902	hsa-miR-3938	CLIP-seq
MIRT2234903	hsa-miR-4742-3p	CLIP-seq
MIRT2234904	hsa-miR-630	CLIP-seq
MIRT1019367	hsa-miR-1280	CLIP-seq
MIRT1019368	hsa-miR-1285	CLIP-seq
MIRT1019381	hsa-miR-3187-5p	CLIP-seq
MIRT1019382	hsa-miR-3194-3p	CLIP-seq
MIRT1019384	hsa-miR-326	CLIP-seq
MIRT1019385	hsa-miR-330-5p	CLIP-seq
MIRT1019386	hsa-miR-33a	CLIP-seq
MIRT1019387	hsa-miR-33b	CLIP-seq
MIRT1019393	hsa-miR-370	CLIP-seq
MIRT1019394	hsa-miR-378g	CLIP-seq
MIRT1019398	hsa-miR-4271	CLIP-seq
MIRT1019405	hsa-miR-4486	CLIP-seq
MIRT1019409	hsa-miR-4640-5p	CLIP-seq
MIRT1019414	hsa-miR-4725-3p	CLIP-seq
MIRT1019415	hsa-miR-4726-5p	CLIP-seq
MIRT2234905	hsa-miR-4731-5p	CLIP-seq
MIRT2234906	hsa-miR-4747-5p	CLIP-seq
MIRT1019422	hsa-miR-548ac	CLIP-seq
MIRT1019423	hsa-miR-548d-3p	CLIP-seq
MIRT1019424	hsa-miR-548z	CLIP-seq
MIRT1019427	hsa-miR-612	CLIP-seq
MIRT2234907	hsa-miR-625	CLIP-seq
MIRT2234908	hsa-miR-637	CLIP-seq
MIRT1019430	hsa-miR-744	CLIP-seq
MIRT1019357	hsa-let-7a	CLIP-seq
MIRT1019358	hsa-let-7b	CLIP-seq
MIRT1019359	hsa-let-7c	CLIP-seq
MIRT1019360	hsa-let-7d	CLIP-seq
MIRT1019361	hsa-let-7e	CLIP-seq
MIRT1019362	hsa-let-7f	CLIP-seq
MIRT1019363	hsa-let-7g	CLIP-seq
MIRT1019364	hsa-let-7i	CLIP-seq
MIRT1019373	hsa-miR-202	CLIP-seq
MIRT1019374	hsa-miR-2110	CLIP-seq
MIRT1019398	hsa-miR-4271	CLIP-seq
MIRT1019402	hsa-miR-4458	CLIP-seq
MIRT1019406	hsa-miR-4500	CLIP-seq
MIRT1019414	hsa-miR-4725-3p	CLIP-seq
MIRT1019433	hsa-miR-98	CLIP-seq
MIRT1019357	hsa-let-7a	CLIP-seq
MIRT1019358	hsa-let-7b	CLIP-seq
MIRT1019359	hsa-let-7c	CLIP-seq
MIRT1019360	hsa-let-7d	CLIP-seq
MIRT1019361	hsa-let-7e	CLIP-seq
MIRT1019362	hsa-let-7f	CLIP-seq
MIRT1019363	hsa-let-7g	CLIP-seq
MIRT1019364	hsa-let-7i	CLIP-seq
MIRT2538757	hsa-miR-1193	CLIP-seq
MIRT2538758	hsa-miR-1207-5p	CLIP-seq
MIRT2538759	hsa-miR-1292	CLIP-seq
MIRT2538760	hsa-miR-1909	CLIP-seq
MIRT1019373	hsa-miR-202	CLIP-seq
MIRT1019374	hsa-miR-2110	CLIP-seq
MIRT1019398	hsa-miR-4271	CLIP-seq
MIRT1019402	hsa-miR-4458	CLIP-seq
MIRT1019406	hsa-miR-4500	CLIP-seq
MIRT1019414	hsa-miR-4725-3p	CLIP-seq
MIRT2538761	hsa-miR-4758-3p	CLIP-seq
MIRT2538762	hsa-miR-4763-3p	CLIP-seq
MIRT2538763	hsa-miR-4781-5p	CLIP-seq
MIRT2538764	hsa-miR-486-3p	CLIP-seq
MIRT1019430	hsa-miR-744	CLIP-seq
MIRT1019433	hsa-miR-98	CLIP-seq
MIRT1019357	hsa-let-7a	CLIP-seq
MIRT1019358	hsa-let-7b	CLIP-seq
MIRT1019359	hsa-let-7c	CLIP-seq
MIRT1019360	hsa-let-7d	CLIP-seq
MIRT1019361	hsa-let-7e	CLIP-seq
MIRT1019362	hsa-let-7f	CLIP-seq
MIRT1019363	hsa-let-7g	CLIP-seq
MIRT1019364	hsa-let-7i	CLIP-seq
MIRT2538757	hsa-miR-1193	CLIP-seq
MIRT2538758	hsa-miR-1207-5p	CLIP-seq
MIRT2681567	hsa-miR-1224-3p	CLIP-seq
MIRT2538759	hsa-miR-1292	CLIP-seq
MIRT2538760	hsa-miR-1909	CLIP-seq
MIRT1019373	hsa-miR-202	CLIP-seq
MIRT1019374	hsa-miR-2110	CLIP-seq
MIRT1019398	hsa-miR-4271	CLIP-seq
MIRT1019402	hsa-miR-4458	CLIP-seq
MIRT1019406	hsa-miR-4500	CLIP-seq
MIRT1019414	hsa-miR-4725-3p	CLIP-seq
MIRT2538761	hsa-miR-4758-3p	CLIP-seq
MIRT2538762	hsa-miR-4763-3p	CLIP-seq
MIRT1019433	hsa-miR-98	CLIP-seq

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0005102	Function	Signaling receptor binding	IPI	15459234
GO:0005515	Function	Protein binding	IPI	9770488, 11441007, 11546783, 16908842, 21291857, 29467281, 32296183, 32814053, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005938	Component	Cell cortex	IDA	12857860
GO:0006605	Process	Protein targeting	IEA
GO:0006605	Process	Protein targeting	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	9770488
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	ISS
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008021	Component	Synaptic vesicle	ISS
GO:0012506	Component	Vesicle membrane	IEA
GO:0012506	Component	Vesicle membrane	ISS
GO:0014047	Process	Glutamate secretion	IEA
GO:0014047	Process	Glutamate secretion	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0017022	Function	Myosin binding	IEA
GO:0017022	Function	Myosin binding	ISS
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030511	Process	Positive regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0031410	Component	Cytoplasmic vesicle	IDA	12857860
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	ISS
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043198	Component	Dendritic shaft	IEA
GO:0043198	Component	Dendritic shaft	ISS
GO:0043542	Process	Endothelial cell migration	IEA
GO:0043542	Process	Endothelial cell migration	ISS
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0048023	Process	Positive regulation of melanin biosynthetic process	IMP	21291857
GO:0048167	Process	Regulation of synaptic plasticity	IEA
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098761	Process	Cellular response to interleukin-7	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA

MIM	HGNC	e!Ensembl
605072	1226	ENSG00000123159

O14908

Protein name

PDZ domain-containing protein GIPC1 (GAIP C-terminus-interacting protein) (RGS-GAIP-interacting protein) (RGS19-interacting protein 1) (Synectin) (Tax interaction protein 2) (TIP-2)

Protein function

May be involved in G protein-linked signaling.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00595	PDZ	133 → 212	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:9770488). Expressed in skeletal muscle (at protein level) (PubMed:32413282). {ECO:0000269|PubMed:32413282, ECO:0000269|PubMed:9770488}.

Sequence

MPLGLGRRKKAPPLVENEEAEPGRGGLGVGEPGPLGGGGSGGPQMGLPPPPPALRPRLVF
HTQLAHGSPTGRIEGFTNVKELYGKIAEAFRLPTAEVMFCTLNTHKVDMDKLLGGQIGLE
DFIFAHVKGQRKEVEVFKSEDALGLTITDNGAGYAFIKRIKEGSVIDHIHLISVGDMIEA
INGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
GTLRLRSRGPATVEDLPSAFEEKAIEKVDDLLESYMGIRDTELAATMVELGKDKRNPDEL
AEALDERLGDFAFPDEFVFDVWGAIGDAKVGRY

Sequence length

333

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BLADDER CALCULUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULOPHARYNGODISTAL MYOPATHY	—	Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet Disgenet, GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULOPHARYNGODISTAL MYOPATHY 2	—	ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (54)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	19509165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10198040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28711793		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31664117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bradyarrhythmia (disorder)	Bradyarrhythmia	BEFREE	30764634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19509165, 21047775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18721484, 18721486, 21209904, 26757732, 34272498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21209904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11956658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21209904		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23743496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23743496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21209904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11836570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21909943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22034985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22034985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22034985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29457830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27481513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	20648052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18721484	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	21209904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	20648052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21209904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	20648052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11956658		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11956658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	29457830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19509165, 21047775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	21047775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11956658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21209904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19509165, 21209904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23128896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11956658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11798178, 21047775, 21209904, 23743496, 29755126, 30456845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23743496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18721484, 18721486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21047775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanosis	Melanosis	BEFREE	31704715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19509165, 21047775, 21432940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculopharyngodistal Myopathy	Oculopharyngodistal myopathy	Pubtator	32413282, 33239111, 33693509, 36055118	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	21209904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18721484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19509165, 21209904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31664117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18314626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21209904, 25469510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34148545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10198040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23128896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	21047775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11956658		★★★★★ ★☆☆☆☆ Found in Text Mining only

GIPC1 (GIPC PDZ domain containing family member 1)