RAI2 (retinoic acid induced 2)

Gene

• Entrez ID: 10742
• Gene name: Retinoic acid induced 2
• Gene symbol: RAI2
• Synonyms (NCBI Gene): -
• Chromosome: X
• Chromosome location: Xp22.13
• Summary: Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined but it may play a role in development. The chromosomal location of this gene des

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051668	hsa-let-7e-5p	CLASH	23622248
MIRT038612	hsa-miR-186-3p	CLASH	23622248
MIRT1288592	hsa-miR-3918	CLIP-seq
MIRT1288593	hsa-miR-4512	CLIP-seq
MIRT1288594	hsa-miR-4757-5p	CLIP-seq
MIRT1288595	hsa-miR-518d-5p	CLIP-seq
MIRT1288596	hsa-miR-519b-5p	CLIP-seq
MIRT1288597	hsa-miR-519c-5p	CLIP-seq
MIRT1288598	hsa-miR-520c-5p	CLIP-seq
MIRT1288599	hsa-miR-526a	CLIP-seq
MIRT1288595	hsa-miR-518d-5p	CLIP-seq
MIRT1288596	hsa-miR-519b-5p	CLIP-seq
MIRT1288597	hsa-miR-519c-5p	CLIP-seq
MIRT1288598	hsa-miR-520c-5p	CLIP-seq
MIRT1288599	hsa-miR-526a	CLIP-seq
MIRT2457704	hsa-miR-330-3p	CLIP-seq
MIRT2457705	hsa-miR-3688-5p	CLIP-seq
MIRT2457706	hsa-miR-4474-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 16713569, 24722188, 25416956, 29892012, 31515488, 32296183, 32814053, 35016035
GO:0005634	Component	Nucleus	IBA
GO:0009792	Process	Embryo development ending in birth or egg hatching	NAS	10049581
GO:0048513	Process	Animal organ development	IBA

Other IDs

• MIM: 300217
• HGNC: 9835
• e!Ensembl: ENSG00000131831

Protein

• UniProt ID: Q9Y5P3
• Protein name: Retinoic acid-induced protein 2
• PDB: 8ARI, 8ATI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15279	SOBP	86 → 250	Sine oculis-binding protein	Family

• Sequence:

  MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILN
  PPAESQSGMALKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPV
  QLPVVLEQHVFQHLNSPLVLPQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEP
  TLPFEAVLQNLFPSQGTLGPPPCQPPPGYAPVPPQPFSSPLSPLVPPATLLVPYPVIVPL
  PVPVPIPIPIPMPQSSESKFSSSFPKPPSSFGLHPFKGTQTPLEKDELKPFDILQPKEYF
  QLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAALDLSVAAHRKSEPPPETL
  YDSGASVDSSGHTVMEKLPSGMEISFAPATSHEAPAMMDSHISSSDAATEMLSQPNHPSG
  EVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDI
  NSQGEESMGNAEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK

• Sequence length: 530

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dextrocardia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anaplasia	Anaplasia	BEFREE	25716347		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25716347, 29796120		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40696381	Associate	★☆☆☆☆ Found in Text Mining only
Cataract, congenital, with microcornea or slight microphthalmia	Congenital Cataract With Microcornea Or Slight Microphthalmia	BEFREE	15370543		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29796120		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	28464487		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25716347, 29796120		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25716347, 25941336		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25716347		★☆☆☆☆ Found in Text Mining only
Nance-Horan syndrome	Nance-Horan Syndrome	BEFREE	10394933, 15370543		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29796120		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25941336		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37899172	Inhibit	★☆☆☆☆ Found in Text Mining only