Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10732
Gene name	Transcription factor like 5
Gene symbol	TCFL5
Synonyms (NCBI Gene)	CHAE2BP-1FiglbSOSF1bHLHe82
Chromosome	20
Chromosome location	20q13.33

Show/Hide all (73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024939	hsa-miR-215-5p	Microarray	19074876
MIRT026827	hsa-miR-192-5p	Microarray	19074876
MIRT051271	hsa-miR-16-5p	CLASH	23622248
MIRT043570	hsa-miR-331-3p	CLASH	23622248
MIRT041545	hsa-miR-193b-3p	CLASH	23622248
MIRT1416532	hsa-miR-1261	CLIP-seq
MIRT1416533	hsa-miR-132	CLIP-seq
MIRT1416534	hsa-miR-137	CLIP-seq
MIRT1416535	hsa-miR-144	CLIP-seq
MIRT1416536	hsa-miR-181a	CLIP-seq
MIRT1416537	hsa-miR-181b	CLIP-seq
MIRT1416538	hsa-miR-181c	CLIP-seq
MIRT1416539	hsa-miR-181d	CLIP-seq
MIRT1416540	hsa-miR-186	CLIP-seq
MIRT1416541	hsa-miR-212	CLIP-seq
MIRT1416542	hsa-miR-25	CLIP-seq
MIRT1416543	hsa-miR-3133	CLIP-seq
MIRT1416544	hsa-miR-3138	CLIP-seq
MIRT1416545	hsa-miR-3149	CLIP-seq
MIRT1416546	hsa-miR-3161	CLIP-seq
MIRT1416547	hsa-miR-3164	CLIP-seq
MIRT1416548	hsa-miR-32	CLIP-seq
MIRT1416549	hsa-miR-363	CLIP-seq
MIRT1416550	hsa-miR-3658	CLIP-seq
MIRT1416551	hsa-miR-367	CLIP-seq
MIRT1416552	hsa-miR-4262	CLIP-seq
MIRT1416553	hsa-miR-4325	CLIP-seq
MIRT1416554	hsa-miR-4422	CLIP-seq
MIRT1416555	hsa-miR-4461	CLIP-seq
MIRT1416556	hsa-miR-4645-3p	CLIP-seq
MIRT1416557	hsa-miR-4698	CLIP-seq
MIRT1416558	hsa-miR-4752	CLIP-seq
MIRT1416559	hsa-miR-4777-5p	CLIP-seq
MIRT1416560	hsa-miR-4800-5p	CLIP-seq
MIRT1416561	hsa-miR-490-5p	CLIP-seq
MIRT1416562	hsa-miR-520d-5p	CLIP-seq
MIRT1416563	hsa-miR-524-5p	CLIP-seq
MIRT1416564	hsa-miR-548n	CLIP-seq
MIRT1416565	hsa-miR-556-3p	CLIP-seq
MIRT1416566	hsa-miR-562	CLIP-seq
MIRT1416567	hsa-miR-577	CLIP-seq
MIRT1416568	hsa-miR-579	CLIP-seq
MIRT1416569	hsa-miR-92a	CLIP-seq
MIRT1416570	hsa-miR-92b	CLIP-seq
MIRT1416535	hsa-miR-144	CLIP-seq
MIRT2124915	hsa-miR-296-3p	CLIP-seq
MIRT2124916	hsa-miR-298	CLIP-seq
MIRT2124917	hsa-miR-3647-3p	CLIP-seq
MIRT2124918	hsa-miR-3678-3p	CLIP-seq
MIRT2124919	hsa-miR-4282	CLIP-seq
MIRT2124920	hsa-miR-4468	CLIP-seq
MIRT2124921	hsa-miR-4685-5p	CLIP-seq
MIRT2124922	hsa-miR-522	CLIP-seq
MIRT2433792	hsa-miR-371-5p	CLIP-seq
MIRT2433793	hsa-miR-371b-5p	CLIP-seq
MIRT2433794	hsa-miR-3973	CLIP-seq
MIRT1416557	hsa-miR-4698	CLIP-seq
MIRT1416562	hsa-miR-520d-5p	CLIP-seq
MIRT2433795	hsa-miR-520g	CLIP-seq
MIRT2433796	hsa-miR-520h	CLIP-seq
MIRT1416563	hsa-miR-524-5p	CLIP-seq
MIRT2433792	hsa-miR-371-5p	CLIP-seq
MIRT2433793	hsa-miR-371b-5p	CLIP-seq
MIRT2433794	hsa-miR-3973	CLIP-seq
MIRT1416557	hsa-miR-4698	CLIP-seq
MIRT1416562	hsa-miR-520d-5p	CLIP-seq
MIRT2433795	hsa-miR-520g	CLIP-seq
MIRT2433796	hsa-miR-520h	CLIP-seq
MIRT1416563	hsa-miR-524-5p	CLIP-seq
MIRT1416533	hsa-miR-132	CLIP-seq
MIRT1416535	hsa-miR-144	CLIP-seq
MIRT1416541	hsa-miR-212	CLIP-seq
MIRT2640341	hsa-miR-515-5p	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12923186
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12923186
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	12923186
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0003677	Function	DNA binding	IDA	9763657
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9763657
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9763657
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	9763657
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	9763657
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEP	9763657
GO:0030154	Process	Cell differentiation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEP	9763657
GO:0045595	Process	Regulation of cell differentiation	IEP	9763657
GO:0046983	Function	Protein dimerization activity	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
604745	11646	ENSG00000101190

Q9UL49

Protein name

Transcription factor-like 5 protein (Cha transcription factor) (HPV-16 E2-binding protein 1) (E2BP-1)

Protein function

Putative transcription factor. Isoform 3 may play a role in early spermatogenesis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	401 → 451	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 3 is testis specific. Isoform 2 is pancreas specific. {ECO:0000269|PubMed:9763657}.

Sequence

MSGPGPREPPPEAGAAGGEAAVEGAGGGDAALGEPGLSFTTTDLSLVEMTEVEYTQLQHI
LCSHMEAAADGELETRLNSALLAAAGPGAGAGGFAAGGQGGAAPVYPVLCPSALAADAPC
LGHIDFQELRMMLLSEAGAAEKTSGGGDGARARADGAAKEGAGAAAAAAGPDGAPEARAK
PAVRVRLEDRFNSIPAEPPPAPRGPEPPEPGGALNNLVTLIRHPSELMNVPLQQQNKCTA
LVKNKTAATTTALQFTYPLFTTNACSTSGNSNLSQTQSSSNSCSVLEAAKHQDIGLPRAF
SFCYQQEIESTKQTLGSRNKVLPEQVWIKVGEAALCKQALKRNRSRMRQLDTNVERRALG
EIQNVGEGATATQGAWQSSESSQANLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRICC
DELNLLVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPD
SLVTCPAQGSLQSSPSMEIK

Sequence length

500

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (30)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22897724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18829976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22897724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	26988835, 30238709, 30371218, 31845556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases, Developmental	Bone Disease	BEFREE	21607596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	22627989, 26988835, 28120557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22897724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17164780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34623757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31111558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	23799896, 8885394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28120557, 30425061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28120557, 30425061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	28346240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17164780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	17164780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28045028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31111558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30038576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26672513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26666680, 29368103, 31076840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	30212954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22627989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17164780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	24014609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	31023126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30764516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	20514429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	24014609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16397242		★★★★★ ★☆☆☆☆ Found in Text Mining only

TCFL5 (transcription factor like 5)