Gene Gene information from NCBI Gene database.
Entrez ID 10728
Gene name Prostaglandin E synthase 3
Gene symbol PTGES3
Synonyms (NCBI Gene)
P23TEBPcPGES
Chromosome 12
Chromosome location 12q13.3|12
Summary This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional a
miRNA miRNA information provided by mirtarbase database.
542
miRTarBase ID miRNA Experiments Reference
MIRT037524 hsa-miR-744-5p CLASH 23622248
MIRT510910 hsa-miR-186-5p PAR-CLIP 20371350
MIRT510909 hsa-miR-3668 PAR-CLIP 20371350
MIRT510908 hsa-miR-4709-5p PAR-CLIP 20371350
MIRT510910 hsa-miR-186-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0000723 Process Telomere maintenance TAS 12135483
GO:0000781 Component Chromosome, telomeric region IC 12135483
GO:0001516 Process Prostaglandin biosynthetic process IBA
GO:0001516 Process Prostaglandin biosynthetic process IDA 10922363
GO:0001516 Process Prostaglandin biosynthetic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607061 16049 ENSG00000110958
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15185
Protein name Prostaglandin E synthase 3 (EC 5.3.99.3) (Cytosolic prostaglandin E2 synthase) (cPGES) (Hsp90 co-chaperone) (Progesterone receptor complex p23) (Telomerase-binding protein p23)
Protein function Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2) (PubMed:10922363). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manne
PDB 1EJF , 7KRJ , 7L7I , 7L7J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04969 CS 4 79 CS domain Domain
Sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRK
GESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE
Sequence length 160
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Arachidonic acid metabolism
Metabolic pathways
Chemical carcinogenesis - receptor activation
  Synthesis of Prostaglandins (PG) and Thromboxanes (TX)
HSP90 chaperone cycle for steroid hormone receptors (SHR)
HSF1 activation
Attenuation phase
Aryl hydrocarbon receptor signalling
ESR-mediated signaling
Estrogen-dependent gene expression
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 21589857
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 27880046
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency BEFREE 25241147
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 25912394
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast Carcinoma Breast Carcinoma BEFREE 20847343, 22074947, 22677230, 24106833
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 10207098, 16809759, 20847343, 22074947, 38245717 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 37416927 Stimulate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 14621192
★☆☆☆☆
Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia Lymphoblastic Leukemia BEFREE 22677230
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma Pubtator 32116234 Associate
★☆☆☆☆
Found in Text Mining only