Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10726
Gene name	Nuclear distribution C, dynein complex regulator
Gene symbol	NUDC
Synonyms (NCBI Gene)	HNUDCMNUDCNPD011
Chromosome	1
Chromosome location	1p36.11
Summary	This gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are

Show/Hide all (4)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030186	hsa-miR-26b-5p	Microarray	19088304
MIRT042392	hsa-miR-483-3p	CLASH	23622248
MIRT042046	hsa-miR-484	CLASH	23622248
MIRT038382	hsa-miR-296-3p	CLASH	23622248

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22159412, 25036637, 25789526, 26638075, 27173435, 28514442, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005819	Component	Spindle	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0006457	Process	Protein folding	IBA
GO:0007052	Process	Mitotic spindle organization	IMP	25789526
GO:0007080	Process	Mitotic metaphase chromosome alignment	IMP	25789526
GO:0007097	Process	Nuclear migration	IEA
GO:0030496	Component	Midbody	IDA	25789526
GO:0030496	Component	Midbody	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051301	Process	Cell division	IEA
GO:0051656	Process	Establishment of organelle localization	IEA
GO:0072686	Component	Mitotic spindle	IDA	25789526

MIM	HGNC	e!Ensembl
610325	8045	ENSG00000090273

Q9Y266

Protein name

Nuclear migration protein nudC (Nuclear distribution protein C homolog)

Protein function

Plays a role in neurogenesis and neuronal migration (By similarity). Necessary for correct formation of mitotic spindles and chromosome separation during mitosis (PubMed:12679384, PubMed:12852857, PubMed:25789526). Necessary for cytokinesis and

PDB

3QOR , 7NDX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14050	Nudc_N	9 → 60	N-terminal conserved domain of Nudc.	Family
PF16273	NuDC	96 → 156	Nuclear distribution C domain	Domain
PF04969	CS	170 → 247	CS domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in fetal liver, kidney, lung and brain. Highly expressed in adult pancreas, kidney, skeletal muscle, liver, lung, placenta, prostate, brain and heart. {ECO:0000269|PubMed:10210332, ECO:0000269|PubMed:104537

Sequence

MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFS
HHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEID
QKKDAENHEAQLKNGSLDSPGKQDTEEDEEEDEKDKGKLKPNLGNGADLPNYRWTQTLSE
LDLAVPFCVNFRLKGKDMVVDIQRRHLRVGLKGQPAIIDGELYNEVKVEESSWLIEDGKV
VTVHLEKINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMG
LPTSDEQKKQEILKKFMDQHPEMDFSKAKFN

Sequence length

331

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11342328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10210332, 11342328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	11342328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11342328		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	11342328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11342328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	10210332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14676831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34060350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NUDC (nuclear distribution C, dynein complex regulator)