CETN3 (centrin 3)

Gene

• Entrez ID: 1070
• Gene name: Centrin 3
• Gene symbol: CETN3
• Synonyms (NCBI Gene): CDC31, CEN3
• Chromosome: 5
• Chromosome location: 5q14.3
• Summary: The protein encoded by this gene contains four EF-hand calcium binding domains, and is a member of the centrin protein family. Centrins are evolutionarily conserved proteins similar to the CDC31 protein of S. cerevisiae. Yeast CDC31 is located at the cent

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023866	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT887333	hsa-miR-23a	CLIP-seq
MIRT887334	hsa-miR-23b	CLIP-seq
MIRT887335	hsa-miR-23c	CLIP-seq
MIRT887336	hsa-miR-382	CLIP-seq
MIRT887337	hsa-miR-4269	CLIP-seq
MIRT887338	hsa-miR-4645-5p	CLIP-seq
MIRT887339	hsa-miR-4673	CLIP-seq
MIRT887340	hsa-miR-4717-3p	CLIP-seq
MIRT887341	hsa-miR-5096	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	23591820, 25416956, 26638075, 27107012, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781, 35271311, 35709258
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005643	Component	Nuclear pore	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005813	Component	Centrosome	IEA
GO:0005814	Component	Centriole	IDA	23591820, 26337392
GO:0005814	Component	Centriole	IEA
GO:0005814	Component	Centriole	TAS	9256449
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007098	Process	Centrosome cycle	TAS	9256449
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0015031	Process	Protein transport	IEA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0032391	Component	Photoreceptor connecting cilium	IEA
GO:0035869	Component	Ciliary transition zone	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0036064	Component	Ciliary basal body	IEA
GO:0044615	Component	Nuclear pore nuclear basket	IDA	23591820
GO:0046872	Function	Metal ion binding	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0051301	Process	Cell division	IEA
GO:0070390	Component	Transcription export complex 2	IDA	23591820

Other IDs

• MIM: 602907
• HGNC: 1868
• e!Ensembl: ENSG00000153140

Protein

• UniProt ID: O15182
• Protein name: Centrin-3
• Protein function: Plays a fundamental role in microtubule-organizing center structure and function.; As a component of the TREX-2 complex, involved in the export of mRNAs to the cytoplasm through the nuclear pores. {ECO:0000269|PubMed:22307388, ECO:0000
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13499	EF-hand_7	27 → 91	EF-hand domain pair	Domain
  PF13499	EF-hand_7	100 → 164	EF-hand domain pair	Domain

• Sequence:

  MSLALRSELVVDKTKRKKRRELSEEQKQEIKDAFELFDTDKDEAIDYHELKVAMRALGFD
  VKKADVLKILKDYDREATGKITFEDFNEVVTDWILERDPHEEILKAFKLFDDDDSGKISL
  RNLRRVARELGENMSDEELRAMIEEFDKDGDGEINQEEFIAIMTGDI

• Sequence length: 167

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BONE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARTILAGE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Astrocytoma	Astrocytoma	BEFREE	23047184		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29642177		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27251275	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29642177		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26339383	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36623729	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	28122956		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20529377	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29642177		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23047184		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26339383		★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	23527013	Associate	★☆☆☆☆ Found in Text Mining only