CCT8 (chaperonin containing TCP1 subunit 8)

Gene

• Entrez ID: 10694
• Gene name: Chaperonin containing TCP1 subunit 8
• Gene symbol: CCT8
• Synonyms (NCBI Gene): C21orf112, Cctq, D21S246, PRED71
• Chromosome: 21
• Chromosome location: 21q21.3
• Summary: This gene encodes the theta subunit of the CCT chaperonin, which is abundant in the eukaryotic cytosol and may be involved in the transport and assembly of newly synthesized proteins. Alternative splicing results in multiple transcript variants of this ge

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051139	hsa-miR-16-5p	CLASH	23622248
MIRT048794	hsa-miR-93-5p	CLASH	23622248
MIRT044212	hsa-miR-301a-3p	CLASH	23622248
MIRT039814	hsa-miR-615-3p	CLASH	23622248
MIRT039814	hsa-miR-615-3p	CLASH	23622248
MIRT039814	hsa-miR-615-3p	CLASH	23622248
MIRT873592	hsa-miR-1283	CLIP-seq
MIRT873593	hsa-miR-1911	CLIP-seq
MIRT873594	hsa-miR-3173-3p	CLIP-seq
MIRT873595	hsa-miR-3614-3p	CLIP-seq
MIRT873596	hsa-miR-412	CLIP-seq
MIRT873597	hsa-miR-4428	CLIP-seq
MIRT873598	hsa-miR-4477b	CLIP-seq
MIRT873599	hsa-miR-4775	CLIP-seq
MIRT873600	hsa-miR-526b	CLIP-seq
MIRT873601	hsa-miR-570	CLIP-seq
MIRT873602	hsa-miR-618	CLIP-seq
MIRT1959146	hsa-miR-101	CLIP-seq
MIRT1959147	hsa-miR-125a-3p	CLIP-seq
MIRT1959148	hsa-miR-139-5p	CLIP-seq
MIRT1959149	hsa-miR-144	CLIP-seq
MIRT873593	hsa-miR-1911	CLIP-seq
MIRT873595	hsa-miR-3614-3p	CLIP-seq
MIRT1959150	hsa-miR-3934	CLIP-seq
MIRT873596	hsa-miR-412	CLIP-seq
MIRT873600	hsa-miR-526b	CLIP-seq
MIRT1959151	hsa-miR-764	CLIP-seq
MIRT1959146	hsa-miR-101	CLIP-seq
MIRT873592	hsa-miR-1283	CLIP-seq
MIRT1959148	hsa-miR-139-5p	CLIP-seq
MIRT1959149	hsa-miR-144	CLIP-seq
MIRT873593	hsa-miR-1911	CLIP-seq
MIRT873595	hsa-miR-3614-3p	CLIP-seq
MIRT873596	hsa-miR-412	CLIP-seq
MIRT873600	hsa-miR-526b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0005515	Function	Protein binding	IPI	14532270, 16085932, 17500595, 25467444, 30021884, 32814053, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	20080638
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	HDA	16780588
GO:0005829	Component	Cytosol	TAS
GO:0005832	Component	Chaperonin-containing T-complex	IBA
GO:0005832	Component	Chaperonin-containing T-complex	IDA	23011926, 30955883
GO:0005832	Component	Chaperonin-containing T-complex	IEA
GO:0005832	Component	Chaperonin-containing T-complex	IPI	22133715
GO:0005832	Component	Chaperonin-containing T-complex	TAS	25467444
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005929	Component	Cilium	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	22133715, 30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	IMP	25467444
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	25467444
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042995	Component	Cell projection	IEA
GO:0044183	Function	Protein folding chaperone	IDA	25467444, 30955883
GO:0044183	Function	Protein folding chaperone	IEA
GO:0044297	Component	Cell body	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0050821	Process	Protein stabilization	IMP	25467444
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS
GO:1904871	Process	Positive regulation of protein localization to Cajal body	HMP	25467444
GO:1904874	Process	Positive regulation of telomerase RNA localization to Cajal body	HMP	25467444

Other IDs

• MIM: 617786
• HGNC: 1623
• e!Ensembl: ENSG00000156261

Protein

• UniProt ID: P50990
• Protein name: T-complex protein 1 subunit theta (TCP-1-theta) (EC 3.6.1.-) (CCT-theta) (Chaperonin containing T-complex polypeptide 1 subunit 8) (Renal carcinoma antigen NY-REN-15)
• Protein function: Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of actin, tubulin and other proteins upon ATP hydrolysis (PubMed:25467444, PubMed:36493755, PubMed:35449234, PubMed:37193829). The TR
• PDB: 6NR8, 6NR9, 6NRA, 6NRB, 6NRC, 6NRD, 6QB8, 7LUM, 7LUP, 7NVL, 7NVM, 7NVN, 7NVO, 7TRG, 7TTN, 7TTT, 7TUB, 7WU7, 7WZ3, 7X0A, 7X0S, 7X0V, 7X3J, 7X3U, 7X6Q, 7X7Y, 8HKI, 8I1U, 8I9U, 8IB8, 8SFE, 8SFF, 8SG8, 8SG9, 8SGC, 8SGL, 8SGQ, 8SH9, 8SHA, 8SHD, 8SHE, 8SHF, 8SHG, 8SHL, 8SHN, 8SHO, 8SHP, 8SHQ, 8SHT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00118	Cpn60_TCP1	39 → 529	TCP-1/cpn60 chaperonin family	Family

• Sequence:

  MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHL
  EKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLR
  IGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLA
  KLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIA
  VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADM
  ALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQV
  VVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA
  KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGL
  DIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
  DWDDDQND

• Sequence length: 548

Pathways

Reactome:

Association of TriC/CCT with target proteins during biosynthesis
BBSome-mediated cargo-targeting to cilium
Neutrophil degranulation
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Azoospermia	Azoospermia	Pubtator	34738918	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26718209	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26304164		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26304164		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26304164		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24862099, 26718209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31632196		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35871080	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24862099, 26304164		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31632196		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29620162		★☆☆☆☆ Found in Text Mining only