GNB5 (G protein subunit beta 5)

Gene

• Entrez ID: 10681
• Gene name: G protein subunit beta 5
• Gene symbol: GNB5
• Synonyms (NCBI Gene): GB5, HG2E, IDDCA, LADCI, LDMLS1, LDMLS2, gbeta5
• Chromosome: 15
• Chromosome location: 15q21.2
• Summary: Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene enc

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs749597091	G>A,C,T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant, synonymous variant
rs761399728	G>A	Pathogenic, not-provided, likely-pathogenic	Missense variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
rs766004901	T>C	Pathogenic	Intron variant, genic upstream transcript variant
rs773902879	G>A	Pathogenic	Stop gained, coding sequence variant, non coding transcript variant
rs886041054	C>T	Pathogenic	Synonymous variant, genic upstream transcript variant, coding sequence variant, non coding transcript variant
rs886041055	C>A	Pathogenic	Genic upstream transcript variant, splice donor variant
rs1085307675	ATCTT>-	Pathogenic, not-provided	Genic upstream transcript variant, non coding transcript variant, coding sequence variant, frameshift variant
rs1261069673	A>-	Likely-pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020117	hsa-miR-130b-3p	Sequencing	20371350
MIRT021914	hsa-miR-128-3p	Sequencing	20371350
MIRT025993	hsa-miR-148a-3p	Sequencing	20371350
MIRT028691	hsa-miR-27a-3p	Sequencing	20371350
MIRT028825	hsa-miR-26b-5p	Microarray	19088304
MIRT039346	hsa-miR-425-5p	CLASH	23622248
MIRT696205	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT696204	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT696203	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT696202	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT696201	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT696200	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT696199	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT696198	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT696197	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT696196	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT696195	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT696194	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT696193	hsa-miR-302e	HITS-CLIP	23313552
MIRT696192	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT696191	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT696190	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT696189	hsa-miR-520b	HITS-CLIP	23313552
MIRT696188	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT696187	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT696186	hsa-miR-520e	HITS-CLIP	23313552
MIRT696185	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT696184	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT696183	hsa-miR-520h	HITS-CLIP	23313552
MIRT696182	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT696181	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT696180	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT696179	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT696178	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT696177	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT696176	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT696175	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT696174	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT696173	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT696172	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT649747	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT649746	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT649744	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT649745	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT649743	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT649742	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT649741	hsa-miR-1976	HITS-CLIP	23824327
MIRT649740	hsa-miR-4279	HITS-CLIP	23824327
MIRT519121	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT519120	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT696205	hsa-miR-106a-5p	HITS-CLIP	27418678
MIRT696204	hsa-miR-106b-5p	HITS-CLIP	27418678
MIRT696181	hsa-miR-1234-3p	HITS-CLIP	27418678
MIRT696179	hsa-miR-150-5p	HITS-CLIP	27418678
MIRT696203	hsa-miR-17-5p	HITS-CLIP	27418678
MIRT696182	hsa-miR-186-3p	HITS-CLIP	27418678
MIRT696202	hsa-miR-20a-5p	HITS-CLIP	27418678
MIRT696201	hsa-miR-20b-5p	HITS-CLIP	27418678
MIRT696197	hsa-miR-302a-3p	HITS-CLIP	27418678
MIRT696196	hsa-miR-302b-3p	HITS-CLIP	27418678
MIRT696195	hsa-miR-302c-3p	HITS-CLIP	27418678
MIRT696194	hsa-miR-302d-3p	HITS-CLIP	27418678
MIRT696193	hsa-miR-302e	HITS-CLIP	27418678
MIRT696192	hsa-miR-372-3p	HITS-CLIP	27418678
MIRT696191	hsa-miR-373-3p	HITS-CLIP	27418678
MIRT696176	hsa-miR-4707-3p	HITS-CLIP	27418678
MIRT696174	hsa-miR-4731-5p	HITS-CLIP	27418678
MIRT696172	hsa-miR-5089-5p	HITS-CLIP	27418678
MIRT696185	hsa-miR-512-3p	HITS-CLIP	27418678
MIRT696200	hsa-miR-519d-3p	HITS-CLIP	27418678
MIRT696190	hsa-miR-520a-3p	HITS-CLIP	27418678
MIRT696189	hsa-miR-520b	HITS-CLIP	27418678
MIRT696188	hsa-miR-520c-3p	HITS-CLIP	27418678
MIRT696187	hsa-miR-520d-3p	HITS-CLIP	27418678
MIRT696186	hsa-miR-520e	HITS-CLIP	27418678
MIRT696184	hsa-miR-520g-3p	HITS-CLIP	27418678
MIRT696183	hsa-miR-520h	HITS-CLIP	27418678
MIRT696199	hsa-miR-526b-3p	HITS-CLIP	27418678
MIRT696173	hsa-miR-5589-5p	HITS-CLIP	27418678
MIRT696178	hsa-miR-619-5p	HITS-CLIP	27418678
MIRT696177	hsa-miR-6506-5p	HITS-CLIP	27418678
MIRT696175	hsa-miR-6778-3p	HITS-CLIP	27418678
MIRT696180	hsa-miR-7107-5p	HITS-CLIP	27418678
MIRT696198	hsa-miR-93-5p	HITS-CLIP	27418678
MIRT696205	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT696204	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT696203	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT696202	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT696201	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT696200	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT696199	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT696198	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT696197	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT696196	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT696195	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT696194	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT696193	hsa-miR-302e	HITS-CLIP	23313552
MIRT696192	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT696191	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT696190	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT696189	hsa-miR-520b	HITS-CLIP	23313552
MIRT696188	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT696187	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT696186	hsa-miR-520e	HITS-CLIP	23313552
MIRT696185	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT696184	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT696183	hsa-miR-520h	HITS-CLIP	23313552
MIRT696182	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT696181	hsa-miR-1234-3p	HITS-CLIP	23313552
MIRT696180	hsa-miR-7107-5p	HITS-CLIP	23313552
MIRT696179	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT696178	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT696177	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT696176	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT696175	hsa-miR-6778-3p	HITS-CLIP	23313552
MIRT696174	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT696173	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT696172	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT649747	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT649746	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT649744	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT649745	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT649743	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT649742	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT649741	hsa-miR-1976	HITS-CLIP	23824327
MIRT649740	hsa-miR-4279	HITS-CLIP	23824327
MIRT519121	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT519120	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT1024090	hsa-miR-106a	CLIP-seq
MIRT1024091	hsa-miR-106b	CLIP-seq
MIRT1024092	hsa-miR-128	CLIP-seq
MIRT1024093	hsa-miR-148a	CLIP-seq
MIRT1024094	hsa-miR-148b	CLIP-seq
MIRT1024095	hsa-miR-152	CLIP-seq
MIRT1024096	hsa-miR-17	CLIP-seq
MIRT1024097	hsa-miR-20a	CLIP-seq
MIRT1024098	hsa-miR-20b	CLIP-seq
MIRT1024099	hsa-miR-27a	CLIP-seq
MIRT1024100	hsa-miR-27b	CLIP-seq
MIRT1024101	hsa-miR-2861	CLIP-seq
MIRT1024102	hsa-miR-302a	CLIP-seq
MIRT1024103	hsa-miR-302b	CLIP-seq
MIRT1024104	hsa-miR-302c	CLIP-seq
MIRT1024105	hsa-miR-302d	CLIP-seq
MIRT1024106	hsa-miR-3065-3p	CLIP-seq
MIRT1024107	hsa-miR-3074-3p	CLIP-seq
MIRT1024108	hsa-miR-3125	CLIP-seq
MIRT1024109	hsa-miR-3163	CLIP-seq
MIRT1024110	hsa-miR-3180-5p	CLIP-seq
MIRT1024111	hsa-miR-3194-3p	CLIP-seq
MIRT1024112	hsa-miR-331-3p	CLIP-seq
MIRT1024113	hsa-miR-3609	CLIP-seq
MIRT1024114	hsa-miR-361-5p	CLIP-seq
MIRT1024115	hsa-miR-3646	CLIP-seq
MIRT1024116	hsa-miR-3647-3p	CLIP-seq
MIRT1024117	hsa-miR-3662	CLIP-seq
MIRT1024118	hsa-miR-372	CLIP-seq
MIRT1024119	hsa-miR-373	CLIP-seq
MIRT1024120	hsa-miR-3916	CLIP-seq
MIRT1024121	hsa-miR-4308	CLIP-seq
MIRT1024122	hsa-miR-4454	CLIP-seq
MIRT1024123	hsa-miR-4476	CLIP-seq
MIRT1024124	hsa-miR-4487	CLIP-seq
MIRT1024125	hsa-miR-4494	CLIP-seq
MIRT1024126	hsa-miR-455-3p	CLIP-seq
MIRT1024127	hsa-miR-4633-3p	CLIP-seq
MIRT1024128	hsa-miR-4645-5p	CLIP-seq
MIRT1024129	hsa-miR-4668-3p	CLIP-seq
MIRT1024130	hsa-miR-4673	CLIP-seq
MIRT1024131	hsa-miR-4700-3p	CLIP-seq
MIRT1024132	hsa-miR-4764-5p	CLIP-seq
MIRT1024133	hsa-miR-4766-5p	CLIP-seq
MIRT1024134	hsa-miR-4796-3p	CLIP-seq
MIRT1024135	hsa-miR-499a-5p	CLIP-seq
MIRT1024136	hsa-miR-5095	CLIP-seq
MIRT1024137	hsa-miR-518a-5p	CLIP-seq
MIRT1024138	hsa-miR-519d	CLIP-seq
MIRT1024139	hsa-miR-520a-5p	CLIP-seq
MIRT1024140	hsa-miR-525-5p	CLIP-seq
MIRT1024141	hsa-miR-527	CLIP-seq
MIRT1024142	hsa-miR-539	CLIP-seq
MIRT1024143	hsa-miR-548ah	CLIP-seq
MIRT1024144	hsa-miR-93	CLIP-seq
MIRT1024145	hsa-miR-1260	CLIP-seq
MIRT1024146	hsa-miR-1260b	CLIP-seq
MIRT1024147	hsa-miR-1304	CLIP-seq
MIRT1024148	hsa-miR-186	CLIP-seq
MIRT1024149	hsa-miR-188-3p	CLIP-seq
MIRT1024150	hsa-miR-219-1-3p	CLIP-seq
MIRT1024151	hsa-miR-2467-5p	CLIP-seq
MIRT1024152	hsa-miR-3156-3p	CLIP-seq
MIRT1024153	hsa-miR-3188	CLIP-seq
MIRT1024154	hsa-miR-3975	CLIP-seq
MIRT1024155	hsa-miR-4263	CLIP-seq
MIRT1024156	hsa-miR-4422	CLIP-seq
MIRT1024122	hsa-miR-4454	CLIP-seq
MIRT1024157	hsa-miR-4509	CLIP-seq
MIRT1024158	hsa-miR-4744	CLIP-seq
MIRT1024159	hsa-miR-4799-5p	CLIP-seq
MIRT1024160	hsa-miR-485-5p	CLIP-seq
MIRT1024161	hsa-miR-5096	CLIP-seq
MIRT1024162	hsa-miR-571	CLIP-seq
MIRT1024163	hsa-miR-576-5p	CLIP-seq
MIRT1024164	hsa-miR-581	CLIP-seq
MIRT2003671	hsa-miR-1270	CLIP-seq
MIRT2003672	hsa-miR-1279	CLIP-seq
MIRT1024092	hsa-miR-128	CLIP-seq
MIRT2003673	hsa-miR-129-5p	CLIP-seq
MIRT2003674	hsa-miR-1299	CLIP-seq
MIRT2003675	hsa-miR-139-3p	CLIP-seq
MIRT2003676	hsa-miR-2276	CLIP-seq
MIRT2003677	hsa-miR-3149	CLIP-seq
MIRT1024110	hsa-miR-3180-5p	CLIP-seq
MIRT2003678	hsa-miR-3199	CLIP-seq
MIRT2003679	hsa-miR-3606	CLIP-seq
MIRT2003680	hsa-miR-3661	CLIP-seq
MIRT2003681	hsa-miR-3940-5p	CLIP-seq
MIRT2003682	hsa-miR-411	CLIP-seq
MIRT2003683	hsa-miR-4257	CLIP-seq
MIRT2003684	hsa-miR-4258	CLIP-seq
MIRT2003685	hsa-miR-4267	CLIP-seq
MIRT2003686	hsa-miR-4268	CLIP-seq
MIRT2003687	hsa-miR-4280	CLIP-seq
MIRT2003688	hsa-miR-4284	CLIP-seq
MIRT2003689	hsa-miR-4315	CLIP-seq
MIRT2003690	hsa-miR-4328	CLIP-seq
MIRT2003691	hsa-miR-4438	CLIP-seq
MIRT2003692	hsa-miR-4507	CLIP-seq
MIRT2003693	hsa-miR-4531	CLIP-seq
MIRT2003694	hsa-miR-4532	CLIP-seq
MIRT2003695	hsa-miR-4635	CLIP-seq
MIRT2003696	hsa-miR-4638-5p	CLIP-seq
MIRT2003697	hsa-miR-4645-3p	CLIP-seq
MIRT2003698	hsa-miR-4678	CLIP-seq
MIRT2003699	hsa-miR-4687-3p	CLIP-seq
MIRT2003700	hsa-miR-4735-5p	CLIP-seq
MIRT2003701	hsa-miR-4775	CLIP-seq
MIRT2003702	hsa-miR-4790-5p	CLIP-seq
MIRT2003703	hsa-miR-493	CLIP-seq
MIRT1024136	hsa-miR-5095	CLIP-seq
MIRT1024161	hsa-miR-5096	CLIP-seq
MIRT1024139	hsa-miR-520a-5p	CLIP-seq
MIRT1024140	hsa-miR-525-5p	CLIP-seq
MIRT2003704	hsa-miR-542-3p	CLIP-seq
MIRT2003705	hsa-miR-590-3p	CLIP-seq
MIRT2003706	hsa-miR-618	CLIP-seq
MIRT2003707	hsa-miR-620	CLIP-seq
MIRT2003708	hsa-miR-630	CLIP-seq
MIRT2003709	hsa-miR-631	CLIP-seq
MIRT2003710	hsa-miR-633	CLIP-seq
MIRT2003711	hsa-miR-720	CLIP-seq
MIRT2003712	hsa-miR-766	CLIP-seq
MIRT2003713	hsa-miR-875-3p	CLIP-seq
MIRT2003714	hsa-miR-889	CLIP-seq
MIRT2003715	hsa-miR-921	CLIP-seq
MIRT1024090	hsa-miR-106a	CLIP-seq
MIRT1024091	hsa-miR-106b	CLIP-seq
MIRT2236477	hsa-miR-1234	CLIP-seq
MIRT1024096	hsa-miR-17	CLIP-seq
MIRT1024097	hsa-miR-20a	CLIP-seq
MIRT1024098	hsa-miR-20b	CLIP-seq
MIRT1024102	hsa-miR-302a	CLIP-seq
MIRT1024103	hsa-miR-302b	CLIP-seq
MIRT1024104	hsa-miR-302c	CLIP-seq
MIRT1024105	hsa-miR-302d	CLIP-seq
MIRT2003678	hsa-miR-3199	CLIP-seq
MIRT1024118	hsa-miR-372	CLIP-seq
MIRT1024119	hsa-miR-373	CLIP-seq
MIRT2003684	hsa-miR-4258	CLIP-seq
MIRT2003688	hsa-miR-4284	CLIP-seq
MIRT2003691	hsa-miR-4438	CLIP-seq
MIRT2003700	hsa-miR-4735-5p	CLIP-seq
MIRT2003701	hsa-miR-4775	CLIP-seq
MIRT1024136	hsa-miR-5095	CLIP-seq
MIRT1024138	hsa-miR-519d	CLIP-seq
MIRT2003705	hsa-miR-590-3p	CLIP-seq
MIRT1024144	hsa-miR-93	CLIP-seq
MIRT1024101	hsa-miR-2861	CLIP-seq
MIRT2003673	hsa-miR-129-5p	CLIP-seq
MIRT2003675	hsa-miR-139-3p	CLIP-seq
MIRT2003677	hsa-miR-3149	CLIP-seq
MIRT2003682	hsa-miR-411	CLIP-seq
MIRT2450448	hsa-miR-4294	CLIP-seq
MIRT2003689	hsa-miR-4315	CLIP-seq
MIRT2003700	hsa-miR-4735-5p	CLIP-seq
MIRT2003701	hsa-miR-4775	CLIP-seq
MIRT2003702	hsa-miR-4790-5p	CLIP-seq
MIRT2003705	hsa-miR-590-3p	CLIP-seq
MIRT2003711	hsa-miR-720	CLIP-seq
MIRT2540182	hsa-miR-1253	CLIP-seq
MIRT2540183	hsa-miR-1254	CLIP-seq
MIRT2003673	hsa-miR-129-5p	CLIP-seq
MIRT2003674	hsa-miR-1299	CLIP-seq
MIRT2540184	hsa-miR-135a	CLIP-seq
MIRT2540185	hsa-miR-135b	CLIP-seq
MIRT1024148	hsa-miR-186	CLIP-seq
MIRT2540186	hsa-miR-1910	CLIP-seq
MIRT2003676	hsa-miR-2276	CLIP-seq
MIRT1024101	hsa-miR-2861	CLIP-seq
MIRT2540187	hsa-miR-3116	CLIP-seq
MIRT2003677	hsa-miR-3149	CLIP-seq
MIRT2540188	hsa-miR-3150b-3p	CLIP-seq
MIRT1024110	hsa-miR-3180-5p	CLIP-seq
MIRT1024112	hsa-miR-331-3p	CLIP-seq
MIRT2540189	hsa-miR-3613-3p	CLIP-seq
MIRT2540190	hsa-miR-3663-5p	CLIP-seq
MIRT2540191	hsa-miR-3918	CLIP-seq
MIRT2540192	hsa-miR-3921	CLIP-seq
MIRT2540193	hsa-miR-3938	CLIP-seq
MIRT2003682	hsa-miR-411	CLIP-seq
MIRT2540194	hsa-miR-4254	CLIP-seq
MIRT2003683	hsa-miR-4257	CLIP-seq
MIRT2003684	hsa-miR-4258	CLIP-seq
MIRT1024155	hsa-miR-4263	CLIP-seq
MIRT2003685	hsa-miR-4267	CLIP-seq
MIRT2003687	hsa-miR-4280	CLIP-seq
MIRT2003688	hsa-miR-4284	CLIP-seq
MIRT1024121	hsa-miR-4308	CLIP-seq
MIRT2540195	hsa-miR-4421	CLIP-seq
MIRT1024156	hsa-miR-4422	CLIP-seq
MIRT1024157	hsa-miR-4509	CLIP-seq
MIRT2540196	hsa-miR-4512	CLIP-seq
MIRT2003694	hsa-miR-4532	CLIP-seq
MIRT2003696	hsa-miR-4638-5p	CLIP-seq
MIRT2003697	hsa-miR-4645-3p	CLIP-seq
MIRT2540197	hsa-miR-4649-3p	CLIP-seq
MIRT2540198	hsa-miR-4653-5p	CLIP-seq
MIRT2003699	hsa-miR-4687-3p	CLIP-seq
MIRT2540199	hsa-miR-4689	CLIP-seq
MIRT1024131	hsa-miR-4700-3p	CLIP-seq
MIRT2540200	hsa-miR-4704-5p	CLIP-seq
MIRT2003700	hsa-miR-4735-5p	CLIP-seq
MIRT1024158	hsa-miR-4744	CLIP-seq
MIRT1024132	hsa-miR-4764-5p	CLIP-seq
MIRT2003701	hsa-miR-4775	CLIP-seq
MIRT2540201	hsa-miR-4784	CLIP-seq
MIRT1024159	hsa-miR-4799-5p	CLIP-seq
MIRT1024136	hsa-miR-5095	CLIP-seq
MIRT1024139	hsa-miR-520a-5p	CLIP-seq
MIRT2540202	hsa-miR-520d-5p	CLIP-seq
MIRT2540203	hsa-miR-524-5p	CLIP-seq
MIRT1024140	hsa-miR-525-5p	CLIP-seq
MIRT2003704	hsa-miR-542-3p	CLIP-seq
MIRT1024163	hsa-miR-576-5p	CLIP-seq
MIRT2003705	hsa-miR-590-3p	CLIP-seq
MIRT2540204	hsa-miR-600	CLIP-seq
MIRT2540205	hsa-miR-7	CLIP-seq
MIRT2003712	hsa-miR-766	CLIP-seq
MIRT2003713	hsa-miR-875-3p	CLIP-seq
MIRT2540182	hsa-miR-1253	CLIP-seq
MIRT2003673	hsa-miR-129-5p	CLIP-seq
MIRT2003674	hsa-miR-1299	CLIP-seq
MIRT2540184	hsa-miR-135a	CLIP-seq
MIRT2540185	hsa-miR-135b	CLIP-seq
MIRT1024148	hsa-miR-186	CLIP-seq
MIRT2540186	hsa-miR-1910	CLIP-seq
MIRT2003676	hsa-miR-2276	CLIP-seq
MIRT1024101	hsa-miR-2861	CLIP-seq
MIRT2003677	hsa-miR-3149	CLIP-seq
MIRT2540188	hsa-miR-3150b-3p	CLIP-seq
MIRT1024110	hsa-miR-3180-5p	CLIP-seq
MIRT1024112	hsa-miR-331-3p	CLIP-seq
MIRT2540189	hsa-miR-3613-3p	CLIP-seq
MIRT2540190	hsa-miR-3663-5p	CLIP-seq
MIRT2540192	hsa-miR-3921	CLIP-seq
MIRT2540193	hsa-miR-3938	CLIP-seq
MIRT2003682	hsa-miR-411	CLIP-seq
MIRT2003683	hsa-miR-4257	CLIP-seq
MIRT2003684	hsa-miR-4258	CLIP-seq
MIRT1024155	hsa-miR-4263	CLIP-seq
MIRT2003685	hsa-miR-4267	CLIP-seq
MIRT2003687	hsa-miR-4280	CLIP-seq
MIRT2003688	hsa-miR-4284	CLIP-seq
MIRT1024121	hsa-miR-4308	CLIP-seq
MIRT2003690	hsa-miR-4328	CLIP-seq
MIRT2540195	hsa-miR-4421	CLIP-seq
MIRT1024156	hsa-miR-4422	CLIP-seq
MIRT1024157	hsa-miR-4509	CLIP-seq
MIRT2003694	hsa-miR-4532	CLIP-seq
MIRT2003696	hsa-miR-4638-5p	CLIP-seq
MIRT2003697	hsa-miR-4645-3p	CLIP-seq
MIRT2540197	hsa-miR-4649-3p	CLIP-seq
MIRT2540198	hsa-miR-4653-5p	CLIP-seq
MIRT2003699	hsa-miR-4687-3p	CLIP-seq
MIRT2540199	hsa-miR-4689	CLIP-seq
MIRT1024131	hsa-miR-4700-3p	CLIP-seq
MIRT2540200	hsa-miR-4704-5p	CLIP-seq
MIRT2003700	hsa-miR-4735-5p	CLIP-seq
MIRT1024158	hsa-miR-4744	CLIP-seq
MIRT1024132	hsa-miR-4764-5p	CLIP-seq
MIRT2003701	hsa-miR-4775	CLIP-seq
MIRT2540201	hsa-miR-4784	CLIP-seq
MIRT1024159	hsa-miR-4799-5p	CLIP-seq
MIRT1024136	hsa-miR-5095	CLIP-seq
MIRT1024139	hsa-miR-520a-5p	CLIP-seq
MIRT2540202	hsa-miR-520d-5p	CLIP-seq
MIRT2540203	hsa-miR-524-5p	CLIP-seq
MIRT1024140	hsa-miR-525-5p	CLIP-seq
MIRT2003704	hsa-miR-542-3p	CLIP-seq
MIRT1024163	hsa-miR-576-5p	CLIP-seq
MIRT2003705	hsa-miR-590-3p	CLIP-seq
MIRT2540204	hsa-miR-600	CLIP-seq
MIRT2003710	hsa-miR-633	CLIP-seq
MIRT2540205	hsa-miR-7	CLIP-seq
MIRT2003712	hsa-miR-766	CLIP-seq
MIRT2003713	hsa-miR-875-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	NAS	9606987
GO:0005096	Function	GTPase activator activity	IDA	27677260
GO:0005096	Function	GTPase activator activity	IDA	10521509
GO:0005515	Function	Protein binding	IPI	12606627, 19376773, 25036637, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	IDA	10521509
GO:0005829	Component	Cytosol	TAS
GO:0005834	Component	Heterotrimeric G-protein complex	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	NAS	9606987
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IBA
GO:0007212	Process	G protein-coupled dopamine receptor signaling pathway	IDA	27677260
GO:0016020	Component	Membrane	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	IBA
GO:0030425	Component	Dendrite	IEA
GO:0031682	Function	G-protein gamma-subunit binding	IPI	12606627
GO:0036367	Process	Light adaption	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	10521509
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051087	Function	Protein-folding chaperone binding	IPI	19376773
GO:0051286	Component	Cell tip	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:1901386	Process	Negative regulation of voltage-gated calcium channel activity	IDA	11007869, 12606627
GO:1902773	Component	GTPase activator complex	TAS	27677260
GO:1990603	Process	Dark adaptation	IEA

Other IDs

• MIM: 604447
• HGNC: 4401
• e!Ensembl: ENSG00000069966

Protein

• UniProt ID: O14775
• Protein name: Guanine nucleotide-binding protein subunit beta-5 (Gbeta5) (Transducin beta chain 5)
• Protein function: Enhances GTPase-activating protein (GAP) activity of regulator of G protein signaling (RGS) proteins, such as RGS7 and RGS9, hence involved in the termination of the signaling initiated by the G protein coupled receptors (GPCRs) by accelerating
• PDB: 7EWP, 7EWR, 8SG8, 8SG9, 8SGC, 8SGL, 8SH9, 8SHA, 8SHD, 8SHE, 8SHF, 8SHG, 8SHL, 8SHN, 8SHO, 8SHP, 8SHQ, 8SHT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00400	WD40	95 → 133	WD domain, G-beta repeat	Repeat
  PF00400	WD40	227 → 267	WD domain, G-beta repeat	Repeat
  PF00400	WD40	271 → 309	WD domain, G-beta repeat	Repeat
  PF00400	WD40	320 → 353	WD domain, G-beta repeat	Repeat
  PF00400	WD40	357 → 394	WD domain, G-beta repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9606987}.
• Sequence:

  MCDQTFLVNVFGSCDKCFKQRALRPVFKKSQQLSYCSTCAEIMATEGLHENETLASLKSE
  AESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRI
  VSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDK
  NENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADV
  LCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGS
  DDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRV
  SILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA

• Sequence length: 395

Pathways

KEGG:

Ras signaling pathway
Chemokine signaling pathway
Hormone signaling
PI3K-Akt signaling pathway
Apelin signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Relaxin signaling pathway
Morphine addiction
Alcoholism
Human cytomegalovirus infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer

Reactome:

Activation of G protein gated Potassium channels
G-protein activation
Inactivation, recovery and regulation of the phototransduction cascade
Glucagon-like Peptide-1 (GLP1) regulates insulin secretion
ADP signalling through P2Y purinoceptor 12
G beta:gamma signalling through PI3Kgamma
Prostacyclin signalling through prostacyclin receptor
Adrenaline,noradrenaline inhibits insulin secretion
Ca2+ pathway
G alpha (q) signalling events
G alpha (12/13) signalling events
G beta:gamma signalling through PLC beta
G alpha (s) signalling events
ADP signalling through P2Y purinoceptor 1
G alpha (i) signalling events
G alpha (z) signalling events
Glucagon-type ligand receptors
Thromboxane signalling through TP receptor
Vasopressin regulates renal water homeostasis via Aquaporins
Thrombin signalling through proteinase activated receptors (PARs)
Presynaptic function of Kainate receptors
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding
G beta:gamma signalling through BTK
G beta:gamma signalling through CDC42
Extra-nuclear estrogen signaling
ADORA2B mediated anti-inflammatory cytokines production
Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Abnormality of the nervous system	Likely pathogenic; Pathogenic	rs2141193854	RCV001814509	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Attention deficit hyperactivity disorder	Pathogenic	rs761399728	RCV000239906	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiovascular phenotype	Likely pathogenic	rs1332666675	RCV005405047	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Delayed speech and language development	Pathogenic	rs761399728	RCV000239906	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Pathogenic; Likely pathogenic	rs761399728	RCV000239906 RCV001255386	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GNB5-related disorder	Pathogenic; Likely pathogenic	rs768022031, rs2543008738, rs886041055	RCV004528520 RCV004529128 RCV003596256	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Gnb5-related intellectual disability-cardiac arrhythmia syndrome	Pathogenic; Likely pathogenic	rs768022031, rs201041536, rs2141181367, rs1379641378, rs761399728, rs886041054, rs773902879, rs886041055, rs749597091, rs2034001586, rs755832695, rs2543008806, rs1085307675	RCV001580374 RCV003989713 RCV002250024 RCV002262192 RCV000709974 RCV000258840 RCV000258819 RCV000258827 RCV000258821 RCV003321474 RCV003321475 RCV003321476 RCV003321477 RCV000709973 RCV001250226 RCV001580375	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
GNB5-reled disorder	Pathogenic	rs768022031	RCV005225440	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Language delay and attention deficit-hyperactivity disorder/cognitive impairment with or without cardiac arrhythmia	Likely pathogenic; Pathogenic	rs2141193854, rs1379641378, rs761399728, rs1085307675, rs749597091	RCV005867158 RCV002262192 RCV000258832 RCV000709973 RCV005252943	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
LODDER-MERLA SYNDROME, TYPE 2, WITH DEVELOPMENTAL DELAY AND CARDIAC ARRHYTHMIA	Pathogenic	rs1085307675	RCV003321635	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL NEUROLOGIC ANOMALIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fraser syndrome 3	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEAL MELANOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	32525932	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	34684344	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	40565581	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autistic Disorder	Autism	BEFREE	30631341		★☆☆☆☆ Found in Text Mining only
Bradycardia	Bradycardia	Pubtator	34573334	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	8679447	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	32525932	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24172857		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	25944804		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	25944804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30719834	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	40565581	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32525932	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	27523599		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	31631344		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31479876		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	31479876	Associate	★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	BEFREE	31631344		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Developmental Delay	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
GNB5-related intellectual disability-cardiac arrhythmia syndrome	Intellectual Disability-Cardiac Arrhythmia Syndrome	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
INTELLECTUAL DEVELOPMENTAL DISORDER WITH CARDIAC ARRHYTHMIA	Intellectual Developmental Disorder With Cardiac Arrhythmia	GENOMICS_ENGLAND_DG	27523599, 29368331		★☆☆☆☆ Found in Text Mining only
INTELLECTUAL DEVELOPMENTAL DISORDER WITH CARDIAC ARRHYTHMIA	Intellectual Developmental Disorder With Cardiac Arrhythmia	ORPHANET_DG	27523599, 30631341		★☆☆☆☆ Found in Text Mining only
INTELLECTUAL DEVELOPMENTAL DISORDER WITH CARDIAC ARRHYTHMIA	Intellectual Developmental Disorder With Cardiac Arrhythmia	BEFREE	29368331		★☆☆☆☆ Found in Text Mining only
INTELLECTUAL DEVELOPMENTAL DISORDER WITH CARDIAC ARRHYTHMIA	Intellectual Developmental Disorder With Cardiac Arrhythmia	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
INTELLECTUAL DEVELOPMENTAL DISORDER WITH CARDIAC ARRHYTHMIA	Intellectual Developmental Disorder With Cardiac Arrhythmia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29368331		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	31479876, 34573334	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
LANGUAGE DELAY AND ATTENTION DEFICIT-HYPERACTIVITY DISORDER/COGNITIVE IMPAIRMENT WITH OR WITHOUT CARDIAC ARRHYTHMIA	Language Delay And Attention Deficit-Hyperactivity Disorder/Cognitive Impairment With Or Without Cardiac Arrhythmia	GENOMICS_ENGLAND_DG	27523599, 29368331		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
LANGUAGE DELAY AND ATTENTION DEFICIT-HYPERACTIVITY DISORDER/COGNITIVE IMPAIRMENT WITH OR WITHOUT CARDIAC ARRHYTHMIA	Language Delay And Attention Deficit-Hyperactivity Disorder/Cognitive Impairment With Or Without Cardiac Arrhythmia	UNIPROT_DG	27523599, 27677260		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
LANGUAGE DELAY AND ATTENTION DEFICIT-HYPERACTIVITY DISORDER/COGNITIVE IMPAIRMENT WITH OR WITHOUT CARDIAC ARRHYTHMIA	Language Delay And Attention Deficit-Hyperactivity Disorder/Cognitive Impairment With Or Without Cardiac Arrhythmia	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
LANGUAGE DELAY AND ATTENTION DEFICIT-HYPERACTIVITY DISORDER/COGNITIVE IMPAIRMENT WITH OR WITHOUT CARDIAC ARRHYTHMIA	Language Delay And Attention Deficit-Hyperactivity Disorder/Cognitive Impairment With Or Without Cardiac Arrhythmia	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24172857		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31631344		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37335694	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35342758, 38255780	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23773523	Associate	★☆☆☆☆ Found in Text Mining only
Salaam Seizures	Salaam Seizures	BEFREE	31631344		★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	38166692	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	8679447	Inhibit	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	31479876	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	31479876	Associate	★☆☆☆☆ Found in Text Mining only