B3GNT2 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2)

Gene

• Entrez ID: 10678
• Gene name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2
• Gene symbol: B3GNT2
• Synonyms (NCBI Gene): 3-Gn-T1, 3-Gn-T2, B3GN-T2, B3GNT, B3GNT-2, B3GNT1, BETA3GNT, BGNT2, BGnT-2, beta-1, beta3Gn-T1, beta3Gn-T2
• Chromosome: 2
• Chromosome location: 2p15
• Summary: This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It prefers the substrate of lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains. Two

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022296	hsa-miR-124-3p	Microarray	18668037
MIRT023499	hsa-miR-1-3p	Microarray	18668037
MIRT303046	hsa-miR-10a-3p	PAR-CLIP	20371350
MIRT089117	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT089105	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT089110	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT089106	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT089111	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT089112	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT089113	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT089119	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT559277	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT089116	hsa-miR-3607-5p	PAR-CLIP	20371350
MIRT303049	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT303052	hsa-miR-6128	PAR-CLIP	20371350
MIRT089115	hsa-miR-643	PAR-CLIP	20371350
MIRT089108	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT089109	hsa-miR-107	PAR-CLIP	20371350
MIRT089118	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT303051	hsa-miR-1299	PAR-CLIP	20371350
MIRT559276	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT559275	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT559274	hsa-miR-5706	PAR-CLIP	20371350
MIRT089114	hsa-miR-568	PAR-CLIP	20371350
MIRT559273	hsa-miR-1248	PAR-CLIP	20371350
MIRT303046	hsa-miR-10a-3p	PAR-CLIP	21572407
MIRT089117	hsa-miR-5583-3p	PAR-CLIP	21572407
MIRT303047	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT303048	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT089105	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT089110	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT089106	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT089111	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT089112	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT089113	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT089119	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT559277	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT089107	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT089116	hsa-miR-3607-5p	PAR-CLIP	21572407
MIRT303049	hsa-miR-875-3p	PAR-CLIP	21572407
MIRT303052	hsa-miR-6128	PAR-CLIP	21572407
MIRT089115	hsa-miR-643	PAR-CLIP	21572407
MIRT089108	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT089109	hsa-miR-107	PAR-CLIP	21572407
MIRT089118	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT303051	hsa-miR-1299	PAR-CLIP	21572407
MIRT559276	hsa-miR-516b-5p	PAR-CLIP	21572407
MIRT559275	hsa-miR-4782-5p	PAR-CLIP	21572407
MIRT559274	hsa-miR-5706	PAR-CLIP	21572407
MIRT089114	hsa-miR-568	PAR-CLIP	21572407
MIRT559273	hsa-miR-1248	PAR-CLIP	21572407
MIRT481095	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT303048	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT481094	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT481093	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT481092	hsa-miR-4699-3p	PAR-CLIP	23592263
MIRT481091	hsa-miR-3919	PAR-CLIP	23592263
MIRT481090	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT481089	hsa-miR-2467-5p	PAR-CLIP	23592263
MIRT303046	hsa-miR-10a-3p	PAR-CLIP	20371350
MIRT089117	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT089105	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT089110	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT089106	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT089111	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT089112	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT089113	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT089119	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT559277	hsa-miR-183-5p	PAR-CLIP	20371350
MIRT089116	hsa-miR-3607-5p	PAR-CLIP	20371350
MIRT303049	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT303052	hsa-miR-6128	PAR-CLIP	20371350
MIRT089115	hsa-miR-643	PAR-CLIP	20371350
MIRT089108	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT089109	hsa-miR-107	PAR-CLIP	20371350
MIRT089118	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT303051	hsa-miR-1299	PAR-CLIP	20371350
MIRT559276	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT559275	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT559274	hsa-miR-5706	PAR-CLIP	20371350
MIRT089114	hsa-miR-568	PAR-CLIP	20371350
MIRT559273	hsa-miR-1248	PAR-CLIP	20371350
MIRT303046	hsa-miR-10a-3p	PAR-CLIP	21572407
MIRT089117	hsa-miR-5583-3p	PAR-CLIP	21572407
MIRT303047	hsa-miR-590-3p	PAR-CLIP	21572407
MIRT303048	hsa-miR-888-5p	PAR-CLIP	21572407
MIRT089105	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT089110	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT089106	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT089111	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT089112	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT089113	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT089119	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT559277	hsa-miR-183-5p	PAR-CLIP	21572407
MIRT089107	hsa-miR-95-5p	PAR-CLIP	21572407
MIRT089116	hsa-miR-3607-5p	PAR-CLIP	21572407
MIRT303049	hsa-miR-875-3p	PAR-CLIP	21572407
MIRT303052	hsa-miR-6128	PAR-CLIP	21572407
MIRT089115	hsa-miR-643	PAR-CLIP	21572407
MIRT089108	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT089109	hsa-miR-107	PAR-CLIP	21572407
MIRT089118	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT303051	hsa-miR-1299	PAR-CLIP	21572407
MIRT559276	hsa-miR-516b-5p	PAR-CLIP	21572407
MIRT559275	hsa-miR-4782-5p	PAR-CLIP	21572407
MIRT559274	hsa-miR-5706	PAR-CLIP	21572407
MIRT089114	hsa-miR-568	PAR-CLIP	21572407
MIRT559273	hsa-miR-1248	PAR-CLIP	21572407
MIRT481095	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT303048	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT481094	hsa-miR-6758-5p	PAR-CLIP	23592263
MIRT481093	hsa-miR-6856-5p	PAR-CLIP	23592263
MIRT481092	hsa-miR-4699-3p	PAR-CLIP	23592263
MIRT481091	hsa-miR-3919	PAR-CLIP	23592263
MIRT481090	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT481089	hsa-miR-2467-5p	PAR-CLIP	23592263
MIRT813260	hsa-miR-103a	CLIP-seq
MIRT813261	hsa-miR-1207-5p	CLIP-seq
MIRT813262	hsa-miR-141	CLIP-seq
MIRT813263	hsa-miR-15a	CLIP-seq
MIRT813264	hsa-miR-15b	CLIP-seq
MIRT813265	hsa-miR-16	CLIP-seq
MIRT813266	hsa-miR-183	CLIP-seq
MIRT813267	hsa-miR-195	CLIP-seq
MIRT813268	hsa-miR-200a	CLIP-seq
MIRT813269	hsa-miR-300	CLIP-seq
MIRT813270	hsa-miR-3065-5p	CLIP-seq
MIRT813271	hsa-miR-3115	CLIP-seq
MIRT813272	hsa-miR-3140-5p	CLIP-seq
MIRT813273	hsa-miR-3147	CLIP-seq
MIRT813274	hsa-miR-3170	CLIP-seq
MIRT813275	hsa-miR-3180-5p	CLIP-seq
MIRT813276	hsa-miR-323b-5p	CLIP-seq
MIRT813277	hsa-miR-340	CLIP-seq
MIRT813278	hsa-miR-342-5p	CLIP-seq
MIRT813279	hsa-miR-3607-3p	CLIP-seq
MIRT813280	hsa-miR-3613-3p	CLIP-seq
MIRT813281	hsa-miR-3647-3p	CLIP-seq
MIRT813282	hsa-miR-3662	CLIP-seq
MIRT813283	hsa-miR-3686	CLIP-seq
MIRT813284	hsa-miR-3692	CLIP-seq
MIRT813285	hsa-miR-376c	CLIP-seq
MIRT813286	hsa-miR-381	CLIP-seq
MIRT813287	hsa-miR-3926	CLIP-seq
MIRT813288	hsa-miR-424	CLIP-seq
MIRT813289	hsa-miR-4269	CLIP-seq
MIRT813290	hsa-miR-4282	CLIP-seq
MIRT813291	hsa-miR-4321	CLIP-seq
MIRT813292	hsa-miR-4425	CLIP-seq
MIRT813293	hsa-miR-4464	CLIP-seq
MIRT813294	hsa-miR-4496	CLIP-seq
MIRT813295	hsa-miR-4528	CLIP-seq
MIRT813296	hsa-miR-4640-3p	CLIP-seq
MIRT813297	hsa-miR-4651	CLIP-seq
MIRT813298	hsa-miR-4664-5p	CLIP-seq
MIRT813299	hsa-miR-4666-3p	CLIP-seq
MIRT813300	hsa-miR-4680-3p	CLIP-seq
MIRT813301	hsa-miR-4704-3p	CLIP-seq
MIRT813302	hsa-miR-4704-5p	CLIP-seq
MIRT813303	hsa-miR-4733-3p	CLIP-seq
MIRT813304	hsa-miR-4736	CLIP-seq
MIRT813305	hsa-miR-4747-5p	CLIP-seq
MIRT813306	hsa-miR-4748	CLIP-seq
MIRT813307	hsa-miR-4763-3p	CLIP-seq
MIRT813308	hsa-miR-4795-3p	CLIP-seq
MIRT813309	hsa-miR-485-3p	CLIP-seq
MIRT813310	hsa-miR-497	CLIP-seq
MIRT813311	hsa-miR-513a-3p	CLIP-seq
MIRT813312	hsa-miR-520a-5p	CLIP-seq
MIRT813313	hsa-miR-520d-5p	CLIP-seq
MIRT813314	hsa-miR-524-5p	CLIP-seq
MIRT813315	hsa-miR-525-5p	CLIP-seq
MIRT813316	hsa-miR-548ac	CLIP-seq
MIRT813317	hsa-miR-548ae	CLIP-seq
MIRT813318	hsa-miR-548aj	CLIP-seq
MIRT813319	hsa-miR-548am	CLIP-seq
MIRT813320	hsa-miR-548d-3p	CLIP-seq
MIRT813321	hsa-miR-548s	CLIP-seq
MIRT813322	hsa-miR-548x	CLIP-seq
MIRT813323	hsa-miR-548z	CLIP-seq
MIRT813324	hsa-miR-584	CLIP-seq
MIRT813325	hsa-miR-608	CLIP-seq
MIRT813326	hsa-miR-656	CLIP-seq
MIRT813327	hsa-miR-888	CLIP-seq
MIRT813328	hsa-miR-935	CLIP-seq
MIRT813260	hsa-miR-103a	CLIP-seq
MIRT1940395	hsa-miR-133a	CLIP-seq
MIRT1940396	hsa-miR-133b	CLIP-seq
MIRT813263	hsa-miR-15a	CLIP-seq
MIRT813264	hsa-miR-15b	CLIP-seq
MIRT813265	hsa-miR-16	CLIP-seq
MIRT813267	hsa-miR-195	CLIP-seq
MIRT1940397	hsa-miR-2052	CLIP-seq
MIRT1940398	hsa-miR-2114	CLIP-seq
MIRT1940399	hsa-miR-2355-5p	CLIP-seq
MIRT1940400	hsa-miR-3163	CLIP-seq
MIRT1940401	hsa-miR-34c-3p	CLIP-seq
MIRT813281	hsa-miR-3647-3p	CLIP-seq
MIRT813282	hsa-miR-3662	CLIP-seq
MIRT813285	hsa-miR-376c	CLIP-seq
MIRT813287	hsa-miR-3926	CLIP-seq
MIRT813288	hsa-miR-424	CLIP-seq
MIRT1940402	hsa-miR-4307	CLIP-seq
MIRT1940403	hsa-miR-4484	CLIP-seq
MIRT813310	hsa-miR-497	CLIP-seq
MIRT1940404	hsa-miR-548an	CLIP-seq
MIRT813321	hsa-miR-548s	CLIP-seq
MIRT1940405	hsa-miR-587	CLIP-seq
MIRT813327	hsa-miR-888	CLIP-seq
MIRT813328	hsa-miR-935	CLIP-seq
MIRT813260	hsa-miR-103a	CLIP-seq
MIRT813261	hsa-miR-1207-5p	CLIP-seq
MIRT2179299	hsa-miR-1228	CLIP-seq
MIRT2179300	hsa-miR-1243	CLIP-seq
MIRT2179301	hsa-miR-1261	CLIP-seq
MIRT2179302	hsa-miR-1264	CLIP-seq
MIRT813262	hsa-miR-141	CLIP-seq
MIRT813263	hsa-miR-15a	CLIP-seq
MIRT813264	hsa-miR-15b	CLIP-seq
MIRT813265	hsa-miR-16	CLIP-seq
MIRT813266	hsa-miR-183	CLIP-seq
MIRT813267	hsa-miR-195	CLIP-seq
MIRT813268	hsa-miR-200a	CLIP-seq
MIRT2179303	hsa-miR-200b	CLIP-seq
MIRT2179304	hsa-miR-200c	CLIP-seq
MIRT1940398	hsa-miR-2114	CLIP-seq
MIRT1940399	hsa-miR-2355-5p	CLIP-seq
MIRT813269	hsa-miR-300	CLIP-seq
MIRT813270	hsa-miR-3065-5p	CLIP-seq
MIRT813271	hsa-miR-3115	CLIP-seq
MIRT813273	hsa-miR-3147	CLIP-seq
MIRT2179305	hsa-miR-3161	CLIP-seq
MIRT1940400	hsa-miR-3163	CLIP-seq
MIRT813274	hsa-miR-3170	CLIP-seq
MIRT2179306	hsa-miR-3187-3p	CLIP-seq
MIRT813276	hsa-miR-323b-5p	CLIP-seq
MIRT813278	hsa-miR-342-5p	CLIP-seq
MIRT2179307	hsa-miR-34b	CLIP-seq
MIRT2179308	hsa-miR-3616-3p	CLIP-seq
MIRT813281	hsa-miR-3647-3p	CLIP-seq
MIRT2179309	hsa-miR-3659	CLIP-seq
MIRT813284	hsa-miR-3692	CLIP-seq
MIRT813285	hsa-miR-376c	CLIP-seq
MIRT813286	hsa-miR-381	CLIP-seq
MIRT2179310	hsa-miR-409-3p	CLIP-seq
MIRT813288	hsa-miR-424	CLIP-seq
MIRT813289	hsa-miR-4269	CLIP-seq
MIRT2179311	hsa-miR-429	CLIP-seq
MIRT2179312	hsa-miR-4328	CLIP-seq
MIRT813292	hsa-miR-4425	CLIP-seq
MIRT2179313	hsa-miR-4435	CLIP-seq
MIRT2179314	hsa-miR-4477b	CLIP-seq
MIRT1940403	hsa-miR-4484	CLIP-seq
MIRT2179315	hsa-miR-450b-5p	CLIP-seq
MIRT2179316	hsa-miR-452	CLIP-seq
MIRT813295	hsa-miR-4528	CLIP-seq
MIRT2179317	hsa-miR-4529-5p	CLIP-seq
MIRT2179318	hsa-miR-4633-5p	CLIP-seq
MIRT813297	hsa-miR-4651	CLIP-seq
MIRT2179319	hsa-miR-4658	CLIP-seq
MIRT813298	hsa-miR-4664-5p	CLIP-seq
MIRT2179320	hsa-miR-4676-3p	CLIP-seq
MIRT2179321	hsa-miR-4698	CLIP-seq
MIRT2179322	hsa-miR-4701-5p	CLIP-seq
MIRT813301	hsa-miR-4704-3p	CLIP-seq
MIRT2179323	hsa-miR-4714-3p	CLIP-seq
MIRT2179324	hsa-miR-4715-5p	CLIP-seq
MIRT2179325	hsa-miR-4733-5p	CLIP-seq
MIRT813304	hsa-miR-4736	CLIP-seq
MIRT813305	hsa-miR-4747-5p	CLIP-seq
MIRT813307	hsa-miR-4763-3p	CLIP-seq
MIRT813308	hsa-miR-4795-3p	CLIP-seq
MIRT2179326	hsa-miR-4803	CLIP-seq
MIRT2179327	hsa-miR-495	CLIP-seq
MIRT813310	hsa-miR-497	CLIP-seq
MIRT2179328	hsa-miR-499-3p	CLIP-seq
MIRT2179329	hsa-miR-499a-3p	CLIP-seq
MIRT2179330	hsa-miR-507	CLIP-seq
MIRT2179331	hsa-miR-5096	CLIP-seq
MIRT813311	hsa-miR-513a-3p	CLIP-seq
MIRT2179332	hsa-miR-518a-5p	CLIP-seq
MIRT2179333	hsa-miR-527	CLIP-seq
MIRT2179334	hsa-miR-532-5p	CLIP-seq
MIRT2179335	hsa-miR-548aa	CLIP-seq
MIRT813316	hsa-miR-548ac	CLIP-seq
MIRT813317	hsa-miR-548ae	CLIP-seq
MIRT813318	hsa-miR-548aj	CLIP-seq
MIRT813319	hsa-miR-548am	CLIP-seq
MIRT1940404	hsa-miR-548an	CLIP-seq
MIRT813320	hsa-miR-548d-3p	CLIP-seq
MIRT813321	hsa-miR-548s	CLIP-seq
MIRT813322	hsa-miR-548x	CLIP-seq
MIRT813323	hsa-miR-548z	CLIP-seq
MIRT2179336	hsa-miR-549	CLIP-seq
MIRT2179337	hsa-miR-557	CLIP-seq
MIRT2179338	hsa-miR-574-5p	CLIP-seq
MIRT2179339	hsa-miR-577	CLIP-seq
MIRT813324	hsa-miR-584	CLIP-seq
MIRT1940405	hsa-miR-587	CLIP-seq
MIRT2179340	hsa-miR-588	CLIP-seq
MIRT2179341	hsa-miR-591	CLIP-seq
MIRT2179342	hsa-miR-597	CLIP-seq
MIRT813325	hsa-miR-608	CLIP-seq
MIRT813326	hsa-miR-656	CLIP-seq
MIRT813327	hsa-miR-888	CLIP-seq
MIRT813328	hsa-miR-935	CLIP-seq
MIRT813285	hsa-miR-376c	CLIP-seq
MIRT813289	hsa-miR-4269	CLIP-seq
MIRT813300	hsa-miR-4680-3p	CLIP-seq
MIRT813327	hsa-miR-888	CLIP-seq
MIRT813328	hsa-miR-935	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IBA
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005515	Function	Protein binding	IPI	18826941, 33961781
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IBA
GO:0007411	Process	Axon guidance	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0008499	Function	N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase activity	TAS
GO:0008532	Function	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity	IBA
GO:0008532	Function	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity	IDA	9892646, 11042166, 25279697
GO:0008532	Function	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity	IEA
GO:0008532	Function	N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016266	Process	Protein O-linked glycosylation via N-acetyl-galactosamine	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016758	Function	Hexosyltransferase activity	IEA
GO:0018146	Process	Keratan sulfate proteoglycan biosynthetic process	TAS
GO:0030311	Process	Poly-N-acetyllactosamine biosynthetic process	IBA
GO:0030311	Process	Poly-N-acetyllactosamine biosynthetic process	IDA	9892646, 11042166, 25279697
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 605581
• HGNC: 15629
• e!Ensembl: ENSG00000170340

Protein

• UniProt ID: Q9NY97
• Protein name: N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 (EC 2.4.1.149) (Beta-1,3-N-acetylglucosaminyltransferase 1) (BGnT-1) (Beta-1,3-Gn-T1) (Beta3Gn-T1) (Beta-1,3-galactosyltransferase 7) (Beta-1,3-GalTase 7) (Beta3Gal-T7) (Beta3GalT7) (b3Gal-T
• Protein function: Beta-1,3-N-acetylglucosaminyltransferase involved in the synthesis of poly-N-acetyllactosamine. Catalyzes the initiation and elongation of poly-N-acetyllactosamine chains. Shows a marked preference for Gal(beta1-4)Glc(NAc)-based acceptors (PubMe
• PDB: 6WMM, 6WMN, 6WMO, 7JHK, 7JHL, 7JHM, 7JHN, 7JHO, 8SZ3, 8TIC, 8TJC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01762	Galactosyl_T	156 → 351	Galactosyltransferase	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11042166}.
• Sequence:

  MSVGRRRIKLLGILMMANVFIYFIMEVSKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWN
  REQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFL
  LYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVF
  LLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEF
  VFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLY
  PPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEE
  KNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC

• Sequence length: 397

Pathways

KEGG:

Glycosaminoglycan biosynthesis - keratan sulfate
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways

Reactome:

Keratan sulfate biosynthesis
O-linked glycosylation of mucins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B3GNT2-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	23577190, 23904455	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23904455	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35073841	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25605193	Associate	★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	27508411		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27004849	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15620693, 27004849	Associate	★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 2	Epileptic encephalopathy	BEFREE	23148524		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35073841	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27871300	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	22446963, 23904455		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves Disease	CTD_human_DG	22446963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Graves Disease	Graves disease	Pubtator	23904455	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	24998922	Associate	★☆☆☆☆ Found in Text Mining only
Infantile Severe Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	23148524		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25605193		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22446963		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23359570		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	25353622		★☆☆☆☆ Found in Text Mining only
MUSCULAR DYSTROPHY-DYSTROGLYCANOPATHY (CONGENITAL WITH BRAIN AND EYE ANOMALIES), TYPE A, 13	Congenital Muscular Dystrophy-Dystroglycanopathy With Brain And Eye Anomalies	GENOMICS_ENGLAND_DG	23877401		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15978110		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28460256		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	23359570		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14555842		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23359570		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21166663		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22446963, 23904455, 2462347		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	22446963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	23904455		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23904455		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23904455	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	34645591, 39468794	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	18385798	Associate	★☆☆☆☆ Found in Text Mining only
Walker-Warburg congenital muscular dystrophy	Walker-Warburg Congenital Muscular Dystrophy	BEFREE	23359570, 23877401, 27508411		★☆☆☆☆ Found in Text Mining only