Gene Gene information from NCBI Gene database.
Entrez ID 10677
Gene name Advillin
Gene symbol AVIL
Synonyms (NCBI Gene)
ADVILDOC6NPHS21p92
Chromosome 12
Chromosome location 12q14.1
Summary The protein encoded by this gene is a member of the gelsolin/villin family of actin regulatory proteins. This protein has structural similarity to villin. It binds actin and may play a role in the development of neuronal cells that form ganglia. [provided
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs138047529 C>T Pathogenic Genic upstream transcript variant, coding sequence variant, upstream transcript variant, missense variant
rs763782471 G>T Pathogenic Coding sequence variant, missense variant
rs1334894971 C>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
24
miRTarBase ID miRNA Experiments Reference
MIRT021358 hsa-miR-9-5p Microarray 17612493
MIRT812252 hsa-miR-331-5p CLIP-seq
MIRT812253 hsa-miR-3609 CLIP-seq
MIRT812254 hsa-miR-4678 CLIP-seq
MIRT812255 hsa-miR-548ah CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0003779 Function Actin binding IEA
GO:0003779 Function Actin binding ISS
GO:0005515 Function Protein binding IPI 29058690
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding IBA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
613397 14188 ENSG00000135407
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75366
Protein name Advillin (p92)
Protein function Ca(2+)-regulated actin-binding protein which plays an important role in actin bundling (PubMed:29058690). May have a unique function in the morphogenesis of neuronal cells which form ganglia. Required for SREC1-mediated regulation of neurite-lik
PDB 1UND
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00626 Gelsolin 23 105 Gelsolin repeat Domain
PF00626 Gelsolin 143 217 Gelsolin repeat Domain
PF00626 Gelsolin 263 340 Gelsolin repeat Domain
PF00626 Gelsolin 404 486 Gelsolin repeat Domain
PF00626 Gelsolin 523 592 Gelsolin repeat Domain
PF00626 Gelsolin 627 705 Gelsolin repeat Domain
PF02209 VHP 784 819 Villin headpiece domain Domain
Tissue specificity TISSUE SPECIFICITY: Most highly expressed in the small intestine and colonic lining. Weaker expression also detected in the thymus, prostate, testes and uterus (PubMed:12034507). Expressed in podocytes (at protein level) (PubMed:29058690). {ECO:0000269|Pu
Sequence
MPLTSAFRAVDNDPGIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIH
FWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFR
GYFKQGIIYKQGGVA
SGMKHVETNTYDVKRLLHVKGKRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESN
SGERLKAMLLAKDIRDRERGGRAKIGVIEGDKEAASP
ELMKVLQDTLGRRSIIKPTVPDE
IIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGA
TKAEKQAAMSKALGFIKMKSYPSSTNVETVNDGAESAMFK
QLFQKWSVKDQTMGLGKTFS
IGKIAKVFQDKFDVTLLHTKPEVAAQERMVDDGNGKVEVWRIENLELVPVEYQWYGFFYG
GDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGT
EPRHFM
AIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSN
DVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTVAEGQEPAEFW
DLLGGKTP
YANDKRLQQEILDVQSRLFECSNKTGQFVVTEITDFTQDDLNPTDVMLLDTWDQVFLWIG
AEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQGFEPPIFT
GWFLAWDPNIWSAGK
TYEQLKEELGDAAAIMRITADMKNATLSLNSNDSEPKYYPIAVLLKNQNQELPEDVNPAK
KENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF
Sequence length 819
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
25
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Gastric cancer Likely pathogenic rs138728046 RCV005931992
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephrotic syndrome Likely pathogenic rs138728046 RCV004798968
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Nephrotic syndrome, type 21 Likely pathogenic; Pathogenic rs138728046, rs1334894971, rs763782471, rs138047529 RCV004698871
RCV000851546
RCV000851543
RCV000851544
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Steroid-resistant nephrotic syndrome Pathogenic; Likely pathogenic rs1334894971, rs763782471, rs138047529 RCV000845156
RCV000845155
RCV000845157
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AVIL-related disorder Uncertain significance; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinogenesis Carcinogenesis Pubtator 37762498 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Embryonal Embryonal carcinoma Pubtator 37762498 Stimulate
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory Bowel Disease BEFREE 12034507
★☆☆☆☆
Found in Text Mining only
Nephrotic Syndrome Nephrotic syndrome Pubtator 29058690 Associate
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Peripheral Nervous System Diseases Nervous System Diseases BEFREE 30126982
★☆☆☆☆
Found in Text Mining only
Peripheral Neuropathy Peripheral Neuropathy BEFREE 30126982
★☆☆☆☆
Found in Text Mining only
Rhabdomyosarcoma Rhabdomyosarcoma Pubtator 37762498 Stimulate
★☆☆☆☆
Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood Steroid resistant nephrotic syndrome BEFREE 29058690
★☆☆☆☆
Found in Text Mining only