Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10670
Gene name	Ras related GTP binding A
Gene symbol	RRAGA
Synonyms (NCBI Gene)	FIP-1FIP1RAGA
Chromosome	9
Chromosome location	9p22.1

Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020749	hsa-miR-155-5p	Proteomics	18668040
MIRT047378	hsa-miR-34a-5p	CLASH	23622248
MIRT1319318	hsa-miR-15a	CLIP-seq
MIRT1319319	hsa-miR-15b	CLIP-seq
MIRT1319320	hsa-miR-16	CLIP-seq
MIRT1319321	hsa-miR-195	CLIP-seq
MIRT1319322	hsa-miR-302f	CLIP-seq
MIRT1319323	hsa-miR-3132	CLIP-seq
MIRT1319324	hsa-miR-330-3p	CLIP-seq
MIRT1319325	hsa-miR-340	CLIP-seq
MIRT1319326	hsa-miR-3669	CLIP-seq
MIRT1319327	hsa-miR-3974	CLIP-seq
MIRT1319328	hsa-miR-424	CLIP-seq
MIRT1319329	hsa-miR-433	CLIP-seq
MIRT1319330	hsa-miR-4330	CLIP-seq
MIRT1319331	hsa-miR-448	CLIP-seq
MIRT1319332	hsa-miR-4484	CLIP-seq
MIRT1319333	hsa-miR-4490	CLIP-seq
MIRT1319334	hsa-miR-450b-5p	CLIP-seq
MIRT1319335	hsa-miR-4639-5p	CLIP-seq
MIRT1319336	hsa-miR-4700-3p	CLIP-seq
MIRT1319337	hsa-miR-4786-3p	CLIP-seq
MIRT1319338	hsa-miR-487a	CLIP-seq
MIRT1319339	hsa-miR-497	CLIP-seq
MIRT1319340	hsa-miR-498	CLIP-seq
MIRT1319341	hsa-miR-548an	CLIP-seq
MIRT1319342	hsa-miR-603	CLIP-seq
MIRT1319343	hsa-miR-664	CLIP-seq
MIRT2094905	hsa-miR-3121-3p	CLIP-seq
MIRT1319323	hsa-miR-3132	CLIP-seq
MIRT1319327	hsa-miR-3974	CLIP-seq
MIRT1319340	hsa-miR-498	CLIP-seq
MIRT2094905	hsa-miR-3121-3p	CLIP-seq
MIRT1319323	hsa-miR-3132	CLIP-seq
MIRT2319273	hsa-miR-3591-5p	CLIP-seq
MIRT2319274	hsa-miR-4255	CLIP-seq
MIRT1319332	hsa-miR-4484	CLIP-seq
MIRT1319333	hsa-miR-4490	CLIP-seq
MIRT1319336	hsa-miR-4700-3p	CLIP-seq
MIRT1319340	hsa-miR-498	CLIP-seq
MIRT1319341	hsa-miR-548an	CLIP-seq

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IDA	28890335
GO:0000166	Function	Nucleotide binding	IEA
GO:0002181	Process	Cytoplasmic translation	IDA	8706699, 34314702
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	31601708, 31601764
GO:0003924	Function	GTPase activity	IEA
GO:0005515	Function	Protein binding	IPI	8995684, 11073942, 14660641, 16189514, 20381137, 22424946, 22575674, 22980980, 25259925, 25561175, 25567906, 25936802, 28336668, 28514442, 32296183, 32433612, 33961781, 37398436
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	7499430, 14660641, 31601708, 31601764
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9394008, 11073942
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	8995684
GO:0005737	Component	Cytoplasm	IDA	9394008, 11073942
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	20381137
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IDA	31601708, 31601764
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0008104	Process	Intracellular protein localization	IMP	20381137
GO:0009267	Process	Cellular response to starvation	IBA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0010507	Process	Negative regulation of autophagy	IBA
GO:0010507	Process	Negative regulation of autophagy	IDA	32561715
GO:0010507	Process	Negative regulation of autophagy	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	25936802
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	25936802
GO:0031669	Process	Cellular response to nutrient levels	IDA	29236692, 29750193, 31601708, 32561715
GO:0031669	Process	Cellular response to nutrient levels	IDA	31601708, 31601764
GO:0032008	Process	Positive regulation of TOR signaling	IEA
GO:0032008	Process	Positive regulation of TOR signaling	NAS	20381137
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	8995684
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IMP	25936802
GO:0035556	Process	Intracellular signal transduction	IDA	9394008
GO:0038202	Process	TORC1 signaling	IDA	12087098, 29750193, 38006878
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	14660641
GO:0043495	Function	Protein-membrane adaptor activity	IDA	31601708, 31601764
GO:0045947	Process	Negative regulation of translational initiation	IDA	22578813
GO:0045948	Process	Positive regulation of translational initiation	IDA	1922062, 29750193
GO:0046982	Function	Protein heterodimerization activity	IPI	11073942, 14660641
GO:0051219	Function	Phosphoprotein binding	IDA	8995684
GO:0061431	Process	Cellular response to methionine	IDA	38006878
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IMP	20381137
GO:0072657	Process	Protein localization to membrane	IDA	31601708, 31601764
GO:1904263	Process	Positive regulation of TORC1 signaling	IBA
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31601708, 31601764
GO:1904263	Process	Positive regulation of TORC1 signaling	IEA
GO:1904263	Process	Positive regulation of TORC1 signaling	IMP	25936802
GO:1990130	Component	GATOR1 complex	IDA	25936802
GO:1990131	Component	Gtr1-Gtr2 GTPase complex	IBA
GO:1990877	Component	FNIP-folliculin RagC/D GAP	IDA	36103527

MIM	HGNC	e!Ensembl
612194	16963	ENSG00000155876

Q7L523

Protein name

Ras-related GTP-binding protein A (Rag A) (RagA) (EC 3.6.5.-) (Adenovirus E3 14.7 kDa-interacting protein 1) (FIP-1)

Protein function

Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade (PubMed:20381137, PubMed:24095279, PubMed:25936802, PubMed:31601708, PubMed:31601

PDB

5X6V , 6CES , 6EHR , 6NZD , 6S6A , 6S6D , 6SB0 , 6SB2 , 6U62 , 6ULG , 6WJ2 , 6WJ3 , 7T3A , 7T3B , 7T3C , 7UX2 , 7UXC , 7UXH , 8DHB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04670	Gtr1_RagA	9 → 235	Gtr1/RagA G protein conserved region	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with highest levels of expression in skeletal muscle, heart, and brain. {ECO:0000269|PubMed:8995684}.

Sequence

MPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATIDVEHSHVRFLGNLVLNL
WDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDA
KIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECACFRTSIWDETLYKAWSSIVYQL
IPNVQQLEMNLRNFAQIIEADEVLLFERATFLVISHYQCKEQRDVHRFEKISNIIKQFKL
SCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKL
ERVDGPKHSLLMR

Sequence length

313

Interactions

View interactions

	KEGG		Reactome
	Autophagy - animal mTOR signaling pathway Shigellosis		Macroautophagy mTOR signalling mTORC1-mediated signalling Energy dependent regulation of mTOR by LKB1-AMPK TP53 Regulates Metabolic Genes E3 ubiquitin ligases ubiquitinate target proteins Regulation of PTEN gene transcription Amino acids regulate mTORC1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CATARACT	—	Disgenet Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Cataract Autosomal Dominant	Congenital cataract	Pubtator	27294265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	22279048, 29029406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32468035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	BEFREE	29061612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	24486648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	22279048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33403789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilia	Hypereosinophilia	BEFREE	22523564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	17549478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	16343267, 16996710, 17549478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22279048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24486648		★★★★★ ★☆☆☆☆ Found in Text Mining only

RRAGA (Ras related GTP binding A)