CGREF1 (cell growth regulator with EF-hand domain 1)

Gene

• Entrez ID: 10669
• Gene name: Cell growth regulator with EF-hand domain 1
• Gene symbol: CGREF1
• Synonyms (NCBI Gene): CGR11
• Chromosome: 2
• Chromosome location: 2p23.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT888375	hsa-miR-3120-3p	CLIP-seq
MIRT888376	hsa-miR-3912	CLIP-seq
MIRT888377	hsa-miR-448	CLIP-seq
MIRT888378	hsa-miR-105	CLIP-seq
MIRT888379	hsa-miR-22	CLIP-seq
MIRT888375	hsa-miR-3120-3p	CLIP-seq
MIRT888377	hsa-miR-448	CLIP-seq
MIRT888380	hsa-miR-4694-3p	CLIP-seq
MIRT1963372	hsa-miR-1184	CLIP-seq
MIRT1963373	hsa-miR-1205	CLIP-seq
MIRT1963374	hsa-miR-1238	CLIP-seq
MIRT1963375	hsa-miR-3127-5p	CLIP-seq
MIRT1963376	hsa-miR-3158-3p	CLIP-seq
MIRT1963377	hsa-miR-3158-5p	CLIP-seq
MIRT1963378	hsa-miR-331-3p	CLIP-seq
MIRT1963379	hsa-miR-3672	CLIP-seq
MIRT1963380	hsa-miR-3677-3p	CLIP-seq
MIRT1963381	hsa-miR-3679-3p	CLIP-seq
MIRT1963382	hsa-miR-3909	CLIP-seq
MIRT1963383	hsa-miR-3918	CLIP-seq
MIRT1963384	hsa-miR-4329	CLIP-seq
MIRT2199795	hsa-miR-1285	CLIP-seq
MIRT2199796	hsa-miR-141	CLIP-seq
MIRT2199797	hsa-miR-200a	CLIP-seq
MIRT2199798	hsa-miR-3187-5p	CLIP-seq
MIRT2199799	hsa-miR-3937	CLIP-seq
MIRT2199800	hsa-miR-612	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	8968090
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IEA

Other IDs

• MIM: 606137
• HGNC: 16962
• e!Ensembl: ENSG00000138028

Protein

• UniProt ID: Q99674
• Protein name: Cell growth regulator with EF hand domain protein 1 (Cell growth regulatory gene 11 protein) (Hydrophobestin)
• Protein function: Mediates cell-cell adhesion in a calcium-dependent manner (By similarity). Able to inhibit growth in several cell lines.
• Sequence:

  MLPLTMTVLILLLLPTGQAAPKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGR
  TEVQLEHLSREQVLLYLFALHDYDQSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVD
  KVLETQDLNGDGLMTPAELINFPGVALRHVEPGEPLAPSPQEPQAVGRQSLLAKSPLRQE
  TQEAPGPREEAKGQVEARRESLDPVQEPGGQAEADGDVPGPRGEAEGQAEAKGDAPGPRG
  EAGGQAEAEGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGETLESK
  NTQNDFEVHIVQVENDEI

• Sequence length: 318

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY OF FRUCTOKINASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40069645	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37370046	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	22991566	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	28108177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	28108177		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36408691	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35234293	Associate	★☆☆☆☆ Found in Text Mining only