Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10666
Gene name	CD226 molecule
Gene symbol	CD226
Synonyms (NCBI Gene)	DNAM-1DNAM1PTA1TLiSA1
Chromosome	18
Chromosome location	18q22.2
Summary	This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and me

273

Show/Hide all (273)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018110	hsa-miR-335-5p	Microarray	18185580
MIRT715737	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT715736	hsa-miR-511-5p	HITS-CLIP	19536157
MIRT715735	hsa-miR-2681-5p	HITS-CLIP	19536157
MIRT525272	hsa-miR-548a-3p	HITS-CLIP	21572407
MIRT525271	hsa-miR-548ar-3p	HITS-CLIP	21572407
MIRT525270	hsa-miR-548az-3p	HITS-CLIP	21572407
MIRT525269	hsa-miR-548e-3p	HITS-CLIP	21572407
MIRT525268	hsa-miR-548f-3p	HITS-CLIP	21572407
MIRT525267	hsa-miR-5582-3p	HITS-CLIP	21572407
MIRT508264	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508263	hsa-miR-4495	HITS-CLIP	21572407
MIRT508262	hsa-miR-379-3p	HITS-CLIP	21572407
MIRT508261	hsa-miR-411-3p	HITS-CLIP	21572407
MIRT508260	hsa-miR-380-3p	HITS-CLIP	21572407
MIRT508258	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508256	hsa-miR-3924	HITS-CLIP	21572407
MIRT508255	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT671143	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT671142	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT671141	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT671140	hsa-miR-1267	HITS-CLIP	23824327
MIRT671139	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT671138	hsa-miR-4294	HITS-CLIP	23824327
MIRT671137	hsa-miR-363-5p	HITS-CLIP	23824327
MIRT671136	hsa-miR-6745	HITS-CLIP	23824327
MIRT671135	hsa-miR-6880-5p	HITS-CLIP	23824327
MIRT671134	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT671133	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT671132	hsa-miR-3672	HITS-CLIP	23824327
MIRT671131	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT671130	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT671129	hsa-miR-8055	HITS-CLIP	23824327
MIRT671128	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT617150	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT617148	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT617147	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT617146	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT617145	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT659692	hsa-miR-1299	HITS-CLIP	23824327
MIRT617144	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT659691	hsa-miR-4782-5p	HITS-CLIP	23824327
MIRT659690	hsa-miR-5706	HITS-CLIP	23824327
MIRT639080	hsa-miR-132-3p	HITS-CLIP	23824327
MIRT639079	hsa-miR-212-3p	HITS-CLIP	23824327
MIRT639078	hsa-miR-4709-5p	HITS-CLIP	23824327
MIRT639077	hsa-miR-16-1-3p	HITS-CLIP	23824327
MIRT639076	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639075	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT639074	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT639073	hsa-miR-421	HITS-CLIP	23824327
MIRT639072	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT639071	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT639070	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT617150	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT617149	hsa-miR-630	HITS-CLIP	23824327
MIRT617148	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT617147	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT617146	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT617145	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT617144	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT508264	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508263	hsa-miR-4495	PAR-CLIP	20371350
MIRT508262	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT508261	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT508260	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT508257	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT508258	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508256	hsa-miR-3924	PAR-CLIP	20371350
MIRT508255	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT525272	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT525271	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT525270	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT525269	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT525268	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT525267	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT508264	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT508263	hsa-miR-4495	PAR-CLIP	22012620
MIRT508262	hsa-miR-379-3p	PAR-CLIP	22012620
MIRT508261	hsa-miR-411-3p	PAR-CLIP	22012620
MIRT508260	hsa-miR-380-3p	PAR-CLIP	22012620
MIRT508258	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT508256	hsa-miR-3924	PAR-CLIP	22012620
MIRT508255	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT525266	hsa-miR-4640-3p	PAR-CLIP	22012620
MIRT525265	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT525264	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT525263	hsa-miR-6798-3p	PAR-CLIP	22012620
MIRT508264	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508263	hsa-miR-4495	PAR-CLIP	23446348
MIRT508262	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT508261	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT508260	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT508259	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508257	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508258	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508256	hsa-miR-3924	PAR-CLIP	23446348
MIRT508255	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT733325	hsa-miR-145-5p	ImmunofluorescenceImmunoprecipitaion (IP)In situ hybridizationLuciferase reporter assayWestern blotting	33859759
MIRT715737	hsa-miR-6830-3p	HITS-CLIP	19536157
MIRT715736	hsa-miR-511-5p	HITS-CLIP	19536157
MIRT715735	hsa-miR-2681-5p	HITS-CLIP	19536157
MIRT525272	hsa-miR-548a-3p	HITS-CLIP	21572407
MIRT525271	hsa-miR-548ar-3p	HITS-CLIP	21572407
MIRT525270	hsa-miR-548az-3p	HITS-CLIP	21572407
MIRT525269	hsa-miR-548e-3p	HITS-CLIP	21572407
MIRT525268	hsa-miR-548f-3p	HITS-CLIP	21572407
MIRT525267	hsa-miR-5582-3p	HITS-CLIP	21572407
MIRT508264	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508263	hsa-miR-4495	HITS-CLIP	21572407
MIRT508262	hsa-miR-379-3p	HITS-CLIP	21572407
MIRT508261	hsa-miR-411-3p	HITS-CLIP	21572407
MIRT508260	hsa-miR-380-3p	HITS-CLIP	21572407
MIRT508258	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508256	hsa-miR-3924	HITS-CLIP	21572407
MIRT508255	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT671143	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT671142	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT671141	hsa-miR-6812-3p	HITS-CLIP	23824327
MIRT671140	hsa-miR-1267	HITS-CLIP	23824327
MIRT671139	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT671138	hsa-miR-4294	HITS-CLIP	23824327
MIRT671137	hsa-miR-363-5p	HITS-CLIP	23824327
MIRT671136	hsa-miR-6745	HITS-CLIP	23824327
MIRT671135	hsa-miR-6880-5p	HITS-CLIP	23824327
MIRT671134	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT671133	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT671132	hsa-miR-3672	HITS-CLIP	23824327
MIRT671131	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT671130	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT671129	hsa-miR-8055	HITS-CLIP	23824327
MIRT671128	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT617150	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT617148	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT617147	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT617146	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT617145	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT659692	hsa-miR-1299	HITS-CLIP	23824327
MIRT617144	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT659691	hsa-miR-4782-5p	HITS-CLIP	23824327
MIRT659690	hsa-miR-5706	HITS-CLIP	23824327
MIRT639080	hsa-miR-132-3p	HITS-CLIP	23824327
MIRT639079	hsa-miR-212-3p	HITS-CLIP	23824327
MIRT639078	hsa-miR-4709-5p	HITS-CLIP	23824327
MIRT639077	hsa-miR-16-1-3p	HITS-CLIP	23824327
MIRT639076	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT639075	hsa-miR-7159-5p	HITS-CLIP	23824327
MIRT639074	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT639073	hsa-miR-421	HITS-CLIP	23824327
MIRT639072	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT639071	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT639070	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT617150	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT617149	hsa-miR-630	HITS-CLIP	23824327
MIRT617148	hsa-miR-6516-3p	HITS-CLIP	23824327
MIRT617147	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT617146	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT617145	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT617144	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT508264	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT508263	hsa-miR-4495	PAR-CLIP	20371350
MIRT508262	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT508261	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT508260	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT508257	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT508258	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508256	hsa-miR-3924	PAR-CLIP	20371350
MIRT508255	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT525272	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT525271	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT525270	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT525269	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT525268	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT525267	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT508264	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT508263	hsa-miR-4495	PAR-CLIP	22012620
MIRT508262	hsa-miR-379-3p	PAR-CLIP	22012620
MIRT508261	hsa-miR-411-3p	PAR-CLIP	22012620
MIRT508260	hsa-miR-380-3p	PAR-CLIP	22012620
MIRT508258	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT508256	hsa-miR-3924	PAR-CLIP	22012620
MIRT508255	hsa-miR-1277-5p	PAR-CLIP	22012620
MIRT525266	hsa-miR-4640-3p	PAR-CLIP	22012620
MIRT525265	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT525264	hsa-miR-6793-3p	PAR-CLIP	22012620
MIRT525263	hsa-miR-6798-3p	PAR-CLIP	22012620
MIRT508264	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508263	hsa-miR-4495	PAR-CLIP	23446348
MIRT508262	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT508261	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT508260	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT508259	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT508257	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT508258	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508256	hsa-miR-3924	PAR-CLIP	23446348
MIRT508255	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT874154	hsa-miR-3182	CLIP-seq
MIRT874155	hsa-miR-378	CLIP-seq
MIRT874156	hsa-miR-378b	CLIP-seq
MIRT874157	hsa-miR-378c	CLIP-seq
MIRT874158	hsa-miR-378d	CLIP-seq
MIRT874159	hsa-miR-378e	CLIP-seq
MIRT874160	hsa-miR-378f	CLIP-seq
MIRT874161	hsa-miR-378h	CLIP-seq
MIRT874162	hsa-miR-378i	CLIP-seq
MIRT874163	hsa-miR-422a	CLIP-seq
MIRT874164	hsa-miR-4638-3p	CLIP-seq
MIRT874165	hsa-miR-4678	CLIP-seq
MIRT874166	hsa-miR-4728-3p	CLIP-seq
MIRT874167	hsa-miR-4777-5p	CLIP-seq
MIRT874168	hsa-miR-516b	CLIP-seq
MIRT874169	hsa-miR-518d-5p	CLIP-seq
MIRT874170	hsa-miR-519b-5p	CLIP-seq
MIRT874171	hsa-miR-519c-5p	CLIP-seq
MIRT874172	hsa-miR-520c-5p	CLIP-seq
MIRT874173	hsa-miR-526a	CLIP-seq
MIRT1959218	hsa-miR-219-2-3p	CLIP-seq
MIRT1959219	hsa-miR-2964a-3p	CLIP-seq
MIRT1959220	hsa-miR-371-5p	CLIP-seq
MIRT1959221	hsa-miR-371b-5p	CLIP-seq
MIRT1959222	hsa-miR-411	CLIP-seq
MIRT1959223	hsa-miR-4680-3p	CLIP-seq
MIRT1959224	hsa-miR-513c	CLIP-seq
MIRT1959225	hsa-miR-514b-5p	CLIP-seq
MIRT1959226	hsa-miR-548n	CLIP-seq
MIRT2196250	hsa-miR-34b	CLIP-seq
MIRT1959220	hsa-miR-371-5p	CLIP-seq
MIRT1959221	hsa-miR-371b-5p	CLIP-seq
MIRT1959222	hsa-miR-411	CLIP-seq
MIRT2196251	hsa-miR-4418	CLIP-seq
MIRT2196252	hsa-miR-509-3-5p	CLIP-seq
MIRT2196253	hsa-miR-509-5p	CLIP-seq
MIRT1959224	hsa-miR-513c	CLIP-seq
MIRT1959225	hsa-miR-514b-5p	CLIP-seq
MIRT1959226	hsa-miR-548n	CLIP-seq
MIRT1959220	hsa-miR-371-5p	CLIP-seq
MIRT1959221	hsa-miR-371b-5p	CLIP-seq
MIRT1959222	hsa-miR-411	CLIP-seq
MIRT1959224	hsa-miR-513c	CLIP-seq
MIRT1959225	hsa-miR-514b-5p	CLIP-seq
MIRT1959226	hsa-miR-548n	CLIP-seq
MIRT1959220	hsa-miR-371-5p	CLIP-seq
MIRT1959221	hsa-miR-371b-5p	CLIP-seq
MIRT1959222	hsa-miR-411	CLIP-seq
MIRT1959224	hsa-miR-513c	CLIP-seq
MIRT1959225	hsa-miR-514b-5p	CLIP-seq
MIRT1959226	hsa-miR-548n	CLIP-seq
MIRT1959220	hsa-miR-371-5p	CLIP-seq
MIRT1959221	hsa-miR-371b-5p	CLIP-seq
MIRT1959222	hsa-miR-411	CLIP-seq
MIRT1959224	hsa-miR-513c	CLIP-seq
MIRT1959225	hsa-miR-514b-5p	CLIP-seq
MIRT1959226	hsa-miR-548n	CLIP-seq
MIRT2465055	hsa-miR-4517	CLIP-seq
MIRT2465056	hsa-miR-4712-3p	CLIP-seq
MIRT2465057	hsa-miR-577	CLIP-seq
MIRT2465058	hsa-miR-580	CLIP-seq
MIRT1959220	hsa-miR-371-5p	CLIP-seq
MIRT1959221	hsa-miR-371b-5p	CLIP-seq
MIRT1959222	hsa-miR-411	CLIP-seq
MIRT1959224	hsa-miR-513c	CLIP-seq
MIRT1959225	hsa-miR-514b-5p	CLIP-seq
MIRT1959226	hsa-miR-548n	CLIP-seq
MIRT1959220	hsa-miR-371-5p	CLIP-seq
MIRT1959221	hsa-miR-371b-5p	CLIP-seq
MIRT1959222	hsa-miR-411	CLIP-seq
MIRT2465055	hsa-miR-4517	CLIP-seq
MIRT2465056	hsa-miR-4712-3p	CLIP-seq
MIRT1959224	hsa-miR-513c	CLIP-seq
MIRT1959225	hsa-miR-514b-5p	CLIP-seq
MIRT1959226	hsa-miR-548n	CLIP-seq
MIRT2465057	hsa-miR-577	CLIP-seq
MIRT2465058	hsa-miR-580	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IEA
GO:0002729	Process	Positive regulation of natural killer cell cytokine production	IEA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	12913096
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	IBA
GO:0002891	Process	Positive regulation of immunoglobulin mediated immune response	IDA	16831868
GO:0005178	Function	Integrin binding	IPI	16831868
GO:0005515	Function	Protein binding	IPI	21982860, 25465800, 26755705, 30591568
GO:0005886	Component	Plasma membrane	IC	15039383
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8673704
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	8673704
GO:0007165	Process	Signal transduction	TAS	8673704
GO:0008037	Process	Cell recognition	TAS	16304049
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	16831868
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	16831868
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0033005	Process	Positive regulation of mast cell activation	IDA	16831868
GO:0038023	Function	Signaling receptor activity	IDA	15039383
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	16582911
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	8673704
GO:0042802	Function	Identical protein binding	IPI	25465800, 30591568
GO:0045121	Component	Membrane raft	TAS	16831868
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IMP	16304049
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0050839	Function	Cell adhesion molecule binding	IPI	12913096
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IBA
GO:0050862	Process	Positive regulation of T cell receptor signaling pathway	IMP	26755705
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	IBA
GO:0060369	Process	Positive regulation of Fc receptor mediated stimulatory signaling pathway	IDA	16831868

MIM	HGNC	e!Ensembl
605397	16961	ENSG00000150637

Q15762

Protein name

CD226 antigen (DNAX accessory molecule 1) (DNAM-1) (CD antigen CD226)

Protein function

Cell surface receptor that plays an important role in the immune system, particularly in intercellular adhesion, lymphocyte signaling, cytotoxicity and lymphokine secretion mediated by cytotoxic T-cells and NK cells (PubMed:8673704, PubMed:97120

PDB

6ISB , 6O3O

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	24 → 126	Immunoglobulin V-set domain	Domain
PF07686	V-set	136 → 241	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by peripheral blood T-lymphocytes. {ECO:0000269|PubMed:8673704}.

Sequence

MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSI
AIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQK
VIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCN
LVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTV
AEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNY
RSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV

Sequence length

336

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (144)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Addison Disease	Addison`s Disease	BEFREE	21521299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	38386917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29299389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29299389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	33452865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18971939, 20444755, 21765104, 23999715, 24673109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	27440135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16210593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29788201		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 2	Autoimmune Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18971939, 19536154, 20338887, 20887380, 21162102, 21521299, 21765104, 22512842, 22531499, 22941566, 23073294, 23980210, 26634488, 26942885, 29338153, 29991650, 30808363 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	18971939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	18971939, 20072139, 22427644, 22531499, 23980210, 35693814, 35971920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases of the Nervous System	Autoimmune nervous system disorder	Pubtator	35733922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31176775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33549054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	23073294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10397272, 10955794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19404979, 22457290, 26936487	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26563374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31024520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34149719	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26563374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	23073294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	23603763, 26974007, 27992413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27655680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11833083, 26238268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16015041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	16015041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16015041		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	16015041		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22189020	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36717657	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn Disease	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12403695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	2168821	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	33413573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	18971939, 20089178, 21765104, 22403184, 24210274, 24891767, 35812428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32035746	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	17554260, 21829393, 25751624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17554260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18971939, 19536154, 19624611, 20089178, 21521299, 21765104, 22941566, 23073294, 24891767, 25980680, 26634488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26910838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	20864642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	20864642		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	37081668	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26563374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	28985649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	19029379		★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	27409423	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	22512842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28109751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32269065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28109751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32849519	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	19536154, 23073294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	19536154, 23073294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22457290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	26910838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	GWASCAT_DG	30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31582819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31582819, 40312552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	20072139, 25057181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15536144, 34504191, 36655432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31234588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30639819, 31212079, 32802845, 34504191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26588911, 28893624, 30639819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Libman-Sacks Disease	Nonbacterial verrucal endocardiosis	CTD_human_DG	26808113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19404979, 27883251, 30411378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	33413573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	26109642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20669283, 34373559, 40312552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34367178	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15661884, 20669283, 20887380, 21765104, 22941566, 27722794		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15661884		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	CTD_human_DG	26808113		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27626490	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24496997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	29217528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	28395975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31176775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30614027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25510399, 30255106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19349689, 19490613, 19748980, 24468679, 26484421, 27461278, 28084312, 30132062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29610289		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	19349689, 25549845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25866972, 30046006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	25866972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19098271	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19748980, 23686482, 24913980, 25609078, 26269456, 27992381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24913980, 25609078, 26269456, 28197392, 30501078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18971939, 18987646, 21765104, 27162345, 39231385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18987646		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19536154, 20508602, 20952449, 21765104, 23073294, 26359290, 30128676		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30705677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	Pubtator	38521068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	2168821, 37491355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis	Pubtator	28985649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16904340, 19029379, 19029380, 19349689, 19490613, 19748980, 24468679, 25384044, 25549845, 26238268, 28395975, 29363227, 30242020, 30504141, 30808363 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27716850, 35967339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28680748, 30999035, 31040907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	34367178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37876933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25274283	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27626490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22403184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pauci-immune Glomerulonephritis associated with Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	BEFREE	19536154, 23073294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	12058255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26719098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	31497016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	21521299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	GWASDB_DG	23603763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	24045107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30614027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	26613086		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	26613086	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	21162102, 22531499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22531499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	29319370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31802539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19536154, 20444755, 21286723, 21765104, 22302395, 22941566, 23073294, 25645050, 27440135, 29319370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	24390342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	24390342		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	23624801, 32082316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	21162102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21162102, 22531499, 37310903	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	39263792	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	33469055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25510399, 30255106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27409423	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30255106, 37056782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21162102, 22531499, 22941566, 23161903, 26109642, 28434122, 29338153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	18971939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919, 26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vasculitis	Vasculitis	Pubtator	19951419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22512842		★★★★★ ★☆☆☆☆ Found in Text Mining only

CD226 (CD226 molecule)