Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10659
Gene name	CUGBP Elav-like family member 2
Gene symbol	CELF2
Synonyms (NCBI Gene)	BRUNOL3CELF-2CUG-BP2CUGBP2DEE97ETR-3ETR3NAPOR
Chromosome	10
Chromosome location	10p14
Summary	Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mR

507

Show/Hide all (507)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016668	hsa-miR-425-5p	Sequencing	20371350
MIRT020050	hsa-miR-375	Microarray	20215506
MIRT051430	hsa-let-7e-5p	CLASH	23622248
MIRT043173	hsa-miR-324-5p	CLASH	23622248
MIRT054423	hsa-miR-95-3p	Luciferase reporter assayqRT-PCRWestern blot	24530415
MIRT054423	hsa-miR-95-3p	Luciferase reporter assayqRT-PCRWestern blot	24530415
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT568087	hsa-miR-548ac	PAR-CLIP	20371350
MIRT568086	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT568085	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT568084	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT568083	hsa-miR-548z	PAR-CLIP	20371350
MIRT568082	hsa-miR-548aa	PAR-CLIP	20371350
MIRT568081	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT568080	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT568078	hsa-miR-4275	PAR-CLIP	20371350
MIRT568079	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT568077	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT442135	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT440858	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT440858	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT382289	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT382290	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT054423	hsa-miR-95-3p	Luciferase reporter assay	26165303
MIRT054423	hsa-miR-95-3p	Luciferase reporter assay	26165303
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT616312	hsa-miR-4464	HITS-CLIP	23824327
MIRT616311	hsa-miR-4748	HITS-CLIP	23824327
MIRT616310	hsa-miR-329-5p	HITS-CLIP	23824327
MIRT055481	hsa-miR-4717-3p	HITS-CLIP	23824327
MIRT616309	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT616308	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT616307	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT616306	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT568087	hsa-miR-548ac	PAR-CLIP	20371350
MIRT568086	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT568085	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT568084	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT568083	hsa-miR-548z	PAR-CLIP	20371350
MIRT568082	hsa-miR-548aa	PAR-CLIP	20371350
MIRT568081	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT568080	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT568078	hsa-miR-4275	PAR-CLIP	20371350
MIRT568079	hsa-miR-203a-3p	PAR-CLIP	20371350
MIRT568077	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT442135	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT883988	hsa-miR-1224-3p	CLIP-seq
MIRT883989	hsa-miR-1248	CLIP-seq
MIRT883990	hsa-miR-1270	CLIP-seq
MIRT883991	hsa-miR-144	CLIP-seq
MIRT883992	hsa-miR-153	CLIP-seq
MIRT883993	hsa-miR-186	CLIP-seq
MIRT883994	hsa-miR-199a-3p	CLIP-seq
MIRT883995	hsa-miR-199b-3p	CLIP-seq
MIRT883996	hsa-miR-224	CLIP-seq
MIRT883997	hsa-miR-30a	CLIP-seq
MIRT883998	hsa-miR-30b	CLIP-seq
MIRT883999	hsa-miR-30c	CLIP-seq
MIRT884000	hsa-miR-30d	CLIP-seq
MIRT884001	hsa-miR-30e	CLIP-seq
MIRT884002	hsa-miR-3120-3p	CLIP-seq
MIRT884003	hsa-miR-3127-3p	CLIP-seq
MIRT884004	hsa-miR-3129-5p	CLIP-seq
MIRT884005	hsa-miR-3133	CLIP-seq
MIRT884006	hsa-miR-3159	CLIP-seq
MIRT884007	hsa-miR-3163	CLIP-seq
MIRT884008	hsa-miR-3607-5p	CLIP-seq
MIRT884009	hsa-miR-3919	CLIP-seq
MIRT884010	hsa-miR-4434	CLIP-seq
MIRT884011	hsa-miR-4477a	CLIP-seq
MIRT884012	hsa-miR-4511	CLIP-seq
MIRT884013	hsa-miR-4516	CLIP-seq
MIRT884014	hsa-miR-451b	CLIP-seq
MIRT884015	hsa-miR-4530	CLIP-seq
MIRT884016	hsa-miR-4531	CLIP-seq
MIRT884017	hsa-miR-4643	CLIP-seq
MIRT884018	hsa-miR-4645-3p	CLIP-seq
MIRT884019	hsa-miR-4705	CLIP-seq
MIRT884020	hsa-miR-4716-5p	CLIP-seq
MIRT884021	hsa-miR-4756-3p	CLIP-seq
MIRT884022	hsa-miR-4762-5p	CLIP-seq
MIRT884023	hsa-miR-4764-3p	CLIP-seq
MIRT884024	hsa-miR-495	CLIP-seq
MIRT884025	hsa-miR-508-5p	CLIP-seq
MIRT884026	hsa-miR-519a	CLIP-seq
MIRT884027	hsa-miR-519b-3p	CLIP-seq
MIRT884028	hsa-miR-519c-3p	CLIP-seq
MIRT884029	hsa-miR-539	CLIP-seq
MIRT884030	hsa-miR-552	CLIP-seq
MIRT884031	hsa-miR-587	CLIP-seq
MIRT884032	hsa-miR-595	CLIP-seq
MIRT884033	hsa-miR-620	CLIP-seq
MIRT884034	hsa-miR-651	CLIP-seq
MIRT884035	hsa-miR-660	CLIP-seq
MIRT884036	hsa-miR-764	CLIP-seq
MIRT884037	hsa-miR-877	CLIP-seq
MIRT884038	hsa-miR-888	CLIP-seq
MIRT884039	hsa-miR-9	CLIP-seq
MIRT884040	hsa-miR-944	CLIP-seq
MIRT884041	hsa-miR-145	CLIP-seq
MIRT884042	hsa-miR-155	CLIP-seq
MIRT884043	hsa-miR-1587	CLIP-seq
MIRT884044	hsa-miR-208a	CLIP-seq
MIRT884045	hsa-miR-208b	CLIP-seq
MIRT884046	hsa-miR-3126-5p	CLIP-seq
MIRT884047	hsa-miR-3175	CLIP-seq
MIRT884048	hsa-miR-3183	CLIP-seq
MIRT884049	hsa-miR-3617	CLIP-seq
MIRT884050	hsa-miR-3658	CLIP-seq
MIRT884051	hsa-miR-3679-3p	CLIP-seq
MIRT884052	hsa-miR-3909	CLIP-seq
MIRT884053	hsa-miR-4265	CLIP-seq
MIRT884054	hsa-miR-4296	CLIP-seq
MIRT884055	hsa-miR-4322	CLIP-seq
MIRT884056	hsa-miR-4417	CLIP-seq
MIRT884010	hsa-miR-4434	CLIP-seq
MIRT884057	hsa-miR-4492	CLIP-seq
MIRT884058	hsa-miR-4498	CLIP-seq
MIRT884013	hsa-miR-4516	CLIP-seq
MIRT884059	hsa-miR-4520a-5p	CLIP-seq
MIRT884060	hsa-miR-4520b-5p	CLIP-seq
MIRT884061	hsa-miR-4656	CLIP-seq
MIRT884062	hsa-miR-4675	CLIP-seq
MIRT884063	hsa-miR-4716-3p	CLIP-seq
MIRT884064	hsa-miR-4723-3p	CLIP-seq
MIRT884065	hsa-miR-4723-5p	CLIP-seq
MIRT884066	hsa-miR-4741	CLIP-seq
MIRT884067	hsa-miR-493	CLIP-seq
MIRT884068	hsa-miR-499-5p	CLIP-seq
MIRT884069	hsa-miR-576-5p	CLIP-seq
MIRT884070	hsa-miR-604	CLIP-seq
MIRT884071	hsa-miR-641	CLIP-seq
MIRT884072	hsa-miR-762	CLIP-seq
MIRT1962103	hsa-miR-1252	CLIP-seq
MIRT883990	hsa-miR-1270	CLIP-seq
MIRT1962104	hsa-miR-129-3p	CLIP-seq
MIRT1962105	hsa-miR-129-5p	CLIP-seq
MIRT1962106	hsa-miR-3605-5p	CLIP-seq
MIRT1962107	hsa-miR-4257	CLIP-seq
MIRT1962108	hsa-miR-431	CLIP-seq
MIRT1962109	hsa-miR-4419a	CLIP-seq
MIRT1962110	hsa-miR-4476	CLIP-seq
MIRT1962111	hsa-miR-4493	CLIP-seq
MIRT1962112	hsa-miR-4510	CLIP-seq
MIRT884016	hsa-miR-4531	CLIP-seq
MIRT1962113	hsa-miR-4633-3p	CLIP-seq
MIRT1962114	hsa-miR-4687-5p	CLIP-seq
MIRT1962115	hsa-miR-513a-3p	CLIP-seq
MIRT884033	hsa-miR-620	CLIP-seq
MIRT1962116	hsa-miR-622	CLIP-seq
MIRT1962117	hsa-miR-513a-5p	CLIP-seq
MIRT1962118	hsa-miR-548t	CLIP-seq
MIRT1962103	hsa-miR-1252	CLIP-seq
MIRT883994	hsa-miR-199a-3p	CLIP-seq
MIRT883995	hsa-miR-199b-3p	CLIP-seq
MIRT2198635	hsa-miR-2115	CLIP-seq
MIRT884004	hsa-miR-3129-5p	CLIP-seq
MIRT2198636	hsa-miR-3185	CLIP-seq
MIRT2198637	hsa-miR-371-5p	CLIP-seq
MIRT2198638	hsa-miR-4253	CLIP-seq
MIRT1962110	hsa-miR-4476	CLIP-seq
MIRT2198639	hsa-miR-4685-5p	CLIP-seq
MIRT2198640	hsa-miR-4699-5p	CLIP-seq
MIRT2198641	hsa-miR-4761-3p	CLIP-seq
MIRT2198642	hsa-miR-4802-3p	CLIP-seq
MIRT2198643	hsa-miR-548g	CLIP-seq
MIRT2198644	hsa-miR-27a	CLIP-seq
MIRT2198645	hsa-miR-27b	CLIP-seq
MIRT2198646	hsa-miR-3609	CLIP-seq
MIRT2198647	hsa-miR-3653	CLIP-seq
MIRT2198648	hsa-miR-4760-3p	CLIP-seq
MIRT2198649	hsa-miR-4796-3p	CLIP-seq
MIRT2198650	hsa-miR-4803	CLIP-seq
MIRT1962117	hsa-miR-513a-5p	CLIP-seq
MIRT2198651	hsa-miR-548ah	CLIP-seq
MIRT2385920	hsa-miR-4436b-5p	CLIP-seq
MIRT2501534	hsa-miR-1179	CLIP-seq
MIRT2501535	hsa-miR-1197	CLIP-seq
MIRT2501536	hsa-miR-1283	CLIP-seq
MIRT1962105	hsa-miR-129-5p	CLIP-seq
MIRT2501537	hsa-miR-1301	CLIP-seq
MIRT2501538	hsa-miR-139-3p	CLIP-seq
MIRT2501539	hsa-miR-140-5p	CLIP-seq
MIRT883991	hsa-miR-144	CLIP-seq
MIRT2501540	hsa-miR-196a	CLIP-seq
MIRT2501541	hsa-miR-196b	CLIP-seq
MIRT2198635	hsa-miR-2115	CLIP-seq
MIRT2501542	hsa-miR-217	CLIP-seq
MIRT2501543	hsa-miR-2276	CLIP-seq
MIRT2501544	hsa-miR-3064-3p	CLIP-seq
MIRT884002	hsa-miR-3120-3p	CLIP-seq
MIRT2501545	hsa-miR-3121-5p	CLIP-seq
MIRT2501546	hsa-miR-3125	CLIP-seq
MIRT2501547	hsa-miR-3132	CLIP-seq
MIRT2501548	hsa-miR-3145-3p	CLIP-seq
MIRT2501549	hsa-miR-3146	CLIP-seq
MIRT2501550	hsa-miR-3147	CLIP-seq
MIRT884006	hsa-miR-3159	CLIP-seq
MIRT2501551	hsa-miR-3160-3p	CLIP-seq
MIRT884007	hsa-miR-3163	CLIP-seq
MIRT2501552	hsa-miR-3179	CLIP-seq
MIRT2501553	hsa-miR-3180-5p	CLIP-seq
MIRT2501554	hsa-miR-3189-5p	CLIP-seq
MIRT2501555	hsa-miR-3202	CLIP-seq
MIRT2501556	hsa-miR-326	CLIP-seq
MIRT2501557	hsa-miR-330-5p	CLIP-seq
MIRT2501558	hsa-miR-3647-3p	CLIP-seq
MIRT2501559	hsa-miR-3662	CLIP-seq
MIRT2198637	hsa-miR-371-5p	CLIP-seq
MIRT2501560	hsa-miR-371b-5p	CLIP-seq
MIRT2501561	hsa-miR-3916	CLIP-seq
MIRT2501562	hsa-miR-3927	CLIP-seq
MIRT2198638	hsa-miR-4253	CLIP-seq
MIRT2501563	hsa-miR-4260	CLIP-seq
MIRT2501564	hsa-miR-4271	CLIP-seq
MIRT2501565	hsa-miR-4300	CLIP-seq
MIRT2501566	hsa-miR-4305	CLIP-seq
MIRT2501567	hsa-miR-4418	CLIP-seq
MIRT2501568	hsa-miR-4422	CLIP-seq
MIRT2501569	hsa-miR-4425	CLIP-seq
MIRT884010	hsa-miR-4434	CLIP-seq
MIRT2501570	hsa-miR-4463	CLIP-seq
MIRT2501571	hsa-miR-4470	CLIP-seq
MIRT884011	hsa-miR-4477a	CLIP-seq
MIRT884013	hsa-miR-4516	CLIP-seq
MIRT884016	hsa-miR-4531	CLIP-seq
MIRT1962113	hsa-miR-4633-3p	CLIP-seq
MIRT884018	hsa-miR-4645-3p	CLIP-seq
MIRT2501572	hsa-miR-4649-3p	CLIP-seq
MIRT2501573	hsa-miR-4650-3p	CLIP-seq
MIRT2501574	hsa-miR-4660	CLIP-seq
MIRT2501575	hsa-miR-4663	CLIP-seq
MIRT2501576	hsa-miR-4671-5p	CLIP-seq
MIRT2501577	hsa-miR-4684-5p	CLIP-seq
MIRT2198639	hsa-miR-4685-5p	CLIP-seq
MIRT2501578	hsa-miR-4695-3p	CLIP-seq
MIRT2501579	hsa-miR-4706	CLIP-seq
MIRT2501580	hsa-miR-4708-3p	CLIP-seq
MIRT2501581	hsa-miR-4715-3p	CLIP-seq
MIRT2501582	hsa-miR-4719	CLIP-seq
MIRT2501583	hsa-miR-4725-3p	CLIP-seq
MIRT2501584	hsa-miR-4735-5p	CLIP-seq
MIRT2501585	hsa-miR-4747-5p	CLIP-seq
MIRT2501586	hsa-miR-4749-5p	CLIP-seq
MIRT2501587	hsa-miR-4758-3p	CLIP-seq
MIRT2501588	hsa-miR-4760-5p	CLIP-seq
MIRT2198641	hsa-miR-4761-3p	CLIP-seq
MIRT2501589	hsa-miR-4776-3p	CLIP-seq
MIRT2501590	hsa-miR-4777-5p	CLIP-seq
MIRT2501591	hsa-miR-4781-5p	CLIP-seq
MIRT2198649	hsa-miR-4796-3p	CLIP-seq
MIRT2501592	hsa-miR-494	CLIP-seq
MIRT2501593	hsa-miR-5047	CLIP-seq
MIRT2501594	hsa-miR-507	CLIP-seq
MIRT2501595	hsa-miR-509-3-5p	CLIP-seq
MIRT2501596	hsa-miR-509-5p	CLIP-seq
MIRT2501597	hsa-miR-518d-5p	CLIP-seq
MIRT2501598	hsa-miR-519b-5p	CLIP-seq
MIRT2501599	hsa-miR-519c-5p	CLIP-seq
MIRT2501600	hsa-miR-520a-5p	CLIP-seq
MIRT2501601	hsa-miR-520c-5p	CLIP-seq
MIRT2501602	hsa-miR-525-5p	CLIP-seq
MIRT2501603	hsa-miR-526a	CLIP-seq
MIRT2501604	hsa-miR-543	CLIP-seq
MIRT2501605	hsa-miR-548c-3p	CLIP-seq
MIRT2501606	hsa-miR-548n	CLIP-seq
MIRT1962118	hsa-miR-548t	CLIP-seq
MIRT2501607	hsa-miR-557	CLIP-seq
MIRT2501608	hsa-miR-581	CLIP-seq
MIRT2501609	hsa-miR-642b	CLIP-seq
MIRT884034	hsa-miR-651	CLIP-seq
MIRT2501610	hsa-miR-7	CLIP-seq
MIRT2501611	hsa-miR-920	CLIP-seq
MIRT2501612	hsa-miR-939	CLIP-seq
MIRT2501534	hsa-miR-1179	CLIP-seq
MIRT2501535	hsa-miR-1197	CLIP-seq
MIRT2677992	hsa-miR-1246	CLIP-seq
MIRT2677993	hsa-miR-1258	CLIP-seq
MIRT2677994	hsa-miR-1266	CLIP-seq
MIRT2501536	hsa-miR-1283	CLIP-seq
MIRT1962105	hsa-miR-129-5p	CLIP-seq
MIRT2501537	hsa-miR-1301	CLIP-seq
MIRT2501539	hsa-miR-140-5p	CLIP-seq
MIRT883991	hsa-miR-144	CLIP-seq
MIRT2677995	hsa-miR-1468	CLIP-seq
MIRT2501540	hsa-miR-196a	CLIP-seq
MIRT2501541	hsa-miR-196b	CLIP-seq
MIRT2198635	hsa-miR-2115	CLIP-seq
MIRT2677996	hsa-miR-214	CLIP-seq
MIRT2501542	hsa-miR-217	CLIP-seq
MIRT2677997	hsa-miR-219-5p	CLIP-seq
MIRT2501543	hsa-miR-2276	CLIP-seq
MIRT2501544	hsa-miR-3064-3p	CLIP-seq
MIRT884002	hsa-miR-3120-3p	CLIP-seq
MIRT2501545	hsa-miR-3121-5p	CLIP-seq
MIRT2501546	hsa-miR-3125	CLIP-seq
MIRT2501547	hsa-miR-3132	CLIP-seq
MIRT2501550	hsa-miR-3147	CLIP-seq
MIRT884006	hsa-miR-3159	CLIP-seq
MIRT2501551	hsa-miR-3160-3p	CLIP-seq
MIRT884007	hsa-miR-3163	CLIP-seq
MIRT2501552	hsa-miR-3179	CLIP-seq
MIRT2501553	hsa-miR-3180-5p	CLIP-seq
MIRT2501554	hsa-miR-3189-5p	CLIP-seq
MIRT2501555	hsa-miR-3202	CLIP-seq
MIRT2501556	hsa-miR-326	CLIP-seq
MIRT2501557	hsa-miR-330-5p	CLIP-seq
MIRT884008	hsa-miR-3607-5p	CLIP-seq
MIRT2677998	hsa-miR-3619-5p	CLIP-seq
MIRT2501558	hsa-miR-3647-3p	CLIP-seq
MIRT2501559	hsa-miR-3662	CLIP-seq
MIRT2198637	hsa-miR-371-5p	CLIP-seq
MIRT2501560	hsa-miR-371b-5p	CLIP-seq
MIRT2677999	hsa-miR-3907	CLIP-seq
MIRT2501561	hsa-miR-3916	CLIP-seq
MIRT2501562	hsa-miR-3927	CLIP-seq
MIRT2198638	hsa-miR-4253	CLIP-seq
MIRT2501563	hsa-miR-4260	CLIP-seq
MIRT2501564	hsa-miR-4271	CLIP-seq
MIRT2678000	hsa-miR-4283	CLIP-seq
MIRT2501565	hsa-miR-4300	CLIP-seq
MIRT2501566	hsa-miR-4305	CLIP-seq
MIRT2501567	hsa-miR-4418	CLIP-seq
MIRT2501568	hsa-miR-4422	CLIP-seq
MIRT2501569	hsa-miR-4425	CLIP-seq
MIRT2678001	hsa-miR-4445	CLIP-seq
MIRT2501570	hsa-miR-4463	CLIP-seq
MIRT2678002	hsa-miR-4489	CLIP-seq
MIRT2678003	hsa-miR-4518	CLIP-seq
MIRT1962113	hsa-miR-4633-3p	CLIP-seq
MIRT884018	hsa-miR-4645-3p	CLIP-seq
MIRT2501572	hsa-miR-4649-3p	CLIP-seq
MIRT2501573	hsa-miR-4650-3p	CLIP-seq
MIRT2501574	hsa-miR-4660	CLIP-seq
MIRT2501575	hsa-miR-4663	CLIP-seq
MIRT2501576	hsa-miR-4671-5p	CLIP-seq
MIRT884062	hsa-miR-4675	CLIP-seq
MIRT2678004	hsa-miR-4677-3p	CLIP-seq
MIRT2501577	hsa-miR-4684-5p	CLIP-seq
MIRT2198639	hsa-miR-4685-5p	CLIP-seq
MIRT2501578	hsa-miR-4695-3p	CLIP-seq
MIRT2678005	hsa-miR-4700-3p	CLIP-seq
MIRT2501579	hsa-miR-4706	CLIP-seq
MIRT2501580	hsa-miR-4708-3p	CLIP-seq
MIRT2501581	hsa-miR-4715-3p	CLIP-seq
MIRT2501582	hsa-miR-4719	CLIP-seq
MIRT2501583	hsa-miR-4725-3p	CLIP-seq
MIRT2501584	hsa-miR-4735-5p	CLIP-seq
MIRT884066	hsa-miR-4741	CLIP-seq
MIRT2501585	hsa-miR-4747-5p	CLIP-seq
MIRT2501586	hsa-miR-4749-5p	CLIP-seq
MIRT2501587	hsa-miR-4758-3p	CLIP-seq
MIRT2501588	hsa-miR-4760-5p	CLIP-seq
MIRT2198641	hsa-miR-4761-3p	CLIP-seq
MIRT2501589	hsa-miR-4776-3p	CLIP-seq
MIRT2501590	hsa-miR-4777-5p	CLIP-seq
MIRT2501591	hsa-miR-4781-5p	CLIP-seq
MIRT2678006	hsa-miR-4782-3p	CLIP-seq
MIRT2198649	hsa-miR-4796-3p	CLIP-seq
MIRT2678007	hsa-miR-490-5p	CLIP-seq
MIRT2501592	hsa-miR-494	CLIP-seq
MIRT2501593	hsa-miR-5047	CLIP-seq
MIRT2501594	hsa-miR-507	CLIP-seq
MIRT2501595	hsa-miR-509-3-5p	CLIP-seq
MIRT2501596	hsa-miR-509-5p	CLIP-seq
MIRT2501597	hsa-miR-518d-5p	CLIP-seq
MIRT2501598	hsa-miR-519b-5p	CLIP-seq
MIRT2501599	hsa-miR-519c-5p	CLIP-seq
MIRT2501600	hsa-miR-520a-5p	CLIP-seq
MIRT2501601	hsa-miR-520c-5p	CLIP-seq
MIRT2501602	hsa-miR-525-5p	CLIP-seq
MIRT2501603	hsa-miR-526a	CLIP-seq
MIRT884029	hsa-miR-539	CLIP-seq
MIRT2501604	hsa-miR-543	CLIP-seq
MIRT2501605	hsa-miR-548c-3p	CLIP-seq
MIRT2501606	hsa-miR-548n	CLIP-seq
MIRT2678008	hsa-miR-548q	CLIP-seq
MIRT1962118	hsa-miR-548t	CLIP-seq
MIRT2501607	hsa-miR-557	CLIP-seq
MIRT2501608	hsa-miR-581	CLIP-seq
MIRT2678009	hsa-miR-582-3p	CLIP-seq
MIRT2678010	hsa-miR-629	CLIP-seq
MIRT2678011	hsa-miR-642a	CLIP-seq
MIRT2501609	hsa-miR-642b	CLIP-seq
MIRT884034	hsa-miR-651	CLIP-seq
MIRT2501610	hsa-miR-7	CLIP-seq
MIRT2678012	hsa-miR-761	CLIP-seq
MIRT2678013	hsa-miR-873	CLIP-seq
MIRT2678014	hsa-miR-885-3p	CLIP-seq
MIRT2501611	hsa-miR-920	CLIP-seq
MIRT2501612	hsa-miR-939	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	9887331
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11158314
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	33131106
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0006376	Process	MRNA splice site recognition	IBA
GO:0006376	Process	MRNA splice site recognition	IDA	11158314
GO:0006376	Process	MRNA splice site recognition	IEA
GO:0006396	Process	RNA processing	TAS	9887331
GO:0006397	Process	MRNA processing	IEA
GO:0008016	Process	Regulation of heart contraction	TAS	9887331
GO:0036002	Function	Pre-mRNA binding	IDA	11158314
GO:0036002	Function	Pre-mRNA binding	IEA
GO:0090543	Component	Flemming body	IDA
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
602538	2550	ENSG00000048740

O95319

Protein name

CUGBP Elav-like family member 2 (CELF-2) (Bruno-like protein 3) (CUG triplet repeat RNA-binding protein 2) (CUG-BP2) (CUG-BP- and ETR-3-like factor 2) (ELAV-type RNA-binding protein 3) (ETR-3) (Neuroblastoma apoptosis-related RNA-binding protein) (hNAPOR)

Protein function

RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-s

PDB

2MY7 , 2MY8 , 4LJM , 4LMZ , 4TLQ , 5M8I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	42 → 113	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	134 → 202	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	425 → 495	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in frontal cortex. Isoform 1 is expressed in brain and lung. Isoform 2 is expressed in heart, brain, placenta, lung, liver, kidney, skeletal muscle and pancreas. Isoform 4 is expressed in heart, lung, skeletal muscle, kidney

Sequence

MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELF
EPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKP
ADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFS
TRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNL
TGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATST
NANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGM
AALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGP
EGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAA
IQAMNGFQIGMKRLKVQLKRSKNDSKPY

Sequence length

508

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CELF2-related disorder	Likely pathogenic	rs201674366	RCV003969575	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Developmental and epileptic encephalopathy 97	Likely pathogenic; Pathogenic	rs2138616482, rs2132786780, rs2132785331, rs2132786873, rs2132785456, rs2132555667	RCV002287501 RCV001728161 RCV001728162 RCV001728163 RCV001814914 RCV002249339 View all (1 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental disorder	Likely pathogenic; Pathogenic	rs2138616482	RCV006249757	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (46)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 14	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOLLICULAR LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC EARLY-ONSET EPILEPTIC ENCEPHALOPATHY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINOSCHISIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNDETERMINED EARLY-ONSET EPILEPTIC ENCEPHALOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (61)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	21379329	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	21379329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	21379329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	11414768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16143398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15033780, 31409895		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	31409895, 33461604, 34288370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	22660636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32271415, 32826865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34288370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18325984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30859622, 31020708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18292181, 36727289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	12110949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of thymus	Congenital Hypoplasia Of Thymus	BEFREE	12110949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	35327643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	12110949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31241130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31241130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26165303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30268547	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30508596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33969722	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	33439746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33576342	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35941836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16143398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34288370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15033780, 31409895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21347286, 26691217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	28319090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29501762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30268547, 31409895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15033780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motion Sickness	Motion Sickness	GWASCAT_DG	25628336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	12606026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	21439371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21439371, 35767654, 8948631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26314850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26314850	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26165303, 31020708, 31241130		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27153397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31241130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35370009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21347286, 26691217		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	28319090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27596159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASCAT_DG	31407831		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	21822266		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	12110949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	15482955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33758106, 40171814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29501762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29501762, 33186122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	25811541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34288370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	33196683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CELF2 (CUGBP Elav-like family member 2)