Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10657
Gene name	KH RNA binding domain containing, signal transduction associated 1
Gene symbol	KHDRBS1
Synonyms (NCBI Gene)	Sam68p62p68
Chromosome	1
Chromosome location	1p35.2
Summary	This gene encodes a member of the K homology domain-containing, RNA-binding, signal transduction-associated protein family. The encoded protein appears to have many functions and may be involved in a variety of cellular processes, including alternative sp

380

Show/Hide all (380)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049690	hsa-miR-92a-3p	CLASH	23622248
MIRT047357	hsa-miR-34a-5p	CLASH	23622248
MIRT046222	hsa-miR-27b-3p	CLASH	23622248
MIRT040829	hsa-miR-18a-3p	CLASH	23622248
MIRT040001	hsa-miR-615-3p	CLASH	23622248
MIRT037105	hsa-miR-877-3p	CLASH	23622248
MIRT731373	hsa-miR-203a-3p	qRT-PCR	26136151
MIRT731373	hsa-miR-203a-3p	qRT-PCR	26136151
MIRT1085161	hsa-miR-105	CLIP-seq
MIRT1085162	hsa-miR-1231	CLIP-seq
MIRT1085163	hsa-miR-1245b-5p	CLIP-seq
MIRT1085164	hsa-miR-1267	CLIP-seq
MIRT1085165	hsa-miR-1323	CLIP-seq
MIRT1085166	hsa-miR-142-5p	CLIP-seq
MIRT1085167	hsa-miR-1470	CLIP-seq
MIRT1085168	hsa-miR-216a	CLIP-seq
MIRT1085169	hsa-miR-218	CLIP-seq
MIRT1085170	hsa-miR-223	CLIP-seq
MIRT1085171	hsa-miR-3074-3p	CLIP-seq
MIRT1085172	hsa-miR-3117-3p	CLIP-seq
MIRT1085173	hsa-miR-3140-3p	CLIP-seq
MIRT1085174	hsa-miR-3142	CLIP-seq
MIRT1085175	hsa-miR-3163	CLIP-seq
MIRT1085176	hsa-miR-3169	CLIP-seq
MIRT1085177	hsa-miR-3182	CLIP-seq
MIRT1085178	hsa-miR-3194-3p	CLIP-seq
MIRT738624	hsa-miR-323-5p	CLIP-seq
MIRT1085179	hsa-miR-329	CLIP-seq
MIRT1085180	hsa-miR-340	CLIP-seq
MIRT1085181	hsa-miR-362-3p	CLIP-seq
MIRT1085182	hsa-miR-3682-5p	CLIP-seq
MIRT1085183	hsa-miR-3689a-3p	CLIP-seq
MIRT1085184	hsa-miR-3689c	CLIP-seq
MIRT1085185	hsa-miR-371-5p	CLIP-seq
MIRT1085186	hsa-miR-371b-5p	CLIP-seq
MIRT1085187	hsa-miR-3908	CLIP-seq
MIRT1085188	hsa-miR-3941	CLIP-seq
MIRT1085189	hsa-miR-409-3p	CLIP-seq
MIRT1085190	hsa-miR-4261	CLIP-seq
MIRT1085191	hsa-miR-4265	CLIP-seq
MIRT1085192	hsa-miR-4275	CLIP-seq
MIRT1085193	hsa-miR-4286	CLIP-seq
MIRT1085194	hsa-miR-4288	CLIP-seq
MIRT1085195	hsa-miR-4296	CLIP-seq
MIRT1085196	hsa-miR-4297	CLIP-seq
MIRT1085197	hsa-miR-4322	CLIP-seq
MIRT1085198	hsa-miR-4328	CLIP-seq
MIRT1085199	hsa-miR-4422	CLIP-seq
MIRT1085200	hsa-miR-4433	CLIP-seq
MIRT1085201	hsa-miR-4459	CLIP-seq
MIRT1085202	hsa-miR-4469	CLIP-seq
MIRT1085203	hsa-miR-4496	CLIP-seq
MIRT1085204	hsa-miR-4503	CLIP-seq
MIRT1085205	hsa-miR-4667-3p	CLIP-seq
MIRT1085206	hsa-miR-4694-3p	CLIP-seq
MIRT1085207	hsa-miR-4695-5p	CLIP-seq
MIRT1085208	hsa-miR-4711-5p	CLIP-seq
MIRT1085209	hsa-miR-4728-5p	CLIP-seq
MIRT1085210	hsa-miR-4735-5p	CLIP-seq
MIRT1085211	hsa-miR-4759	CLIP-seq
MIRT1085212	hsa-miR-4766-5p	CLIP-seq
MIRT1085213	hsa-miR-4768-3p	CLIP-seq
MIRT1085214	hsa-miR-4775	CLIP-seq
MIRT1085215	hsa-miR-4795-3p	CLIP-seq
MIRT1085216	hsa-miR-494	CLIP-seq
MIRT1085217	hsa-miR-548m	CLIP-seq
MIRT1085218	hsa-miR-548o	CLIP-seq
MIRT1085219	hsa-miR-555	CLIP-seq
MIRT1085220	hsa-miR-569	CLIP-seq
MIRT1085221	hsa-miR-590-3p	CLIP-seq
MIRT1085222	hsa-miR-603	CLIP-seq
MIRT1085223	hsa-miR-616	CLIP-seq
MIRT1085224	hsa-miR-632	CLIP-seq
MIRT1085225	hsa-miR-636	CLIP-seq
MIRT1085226	hsa-miR-642a	CLIP-seq
MIRT1085227	hsa-miR-758	CLIP-seq
MIRT738625	hsa-miR-876-3p	CLIP-seq
MIRT1922167	hsa-miR-1343	CLIP-seq
MIRT1922168	hsa-miR-3192	CLIP-seq
MIRT1085161	hsa-miR-105	CLIP-seq
MIRT2021712	hsa-miR-122	CLIP-seq
MIRT1085162	hsa-miR-1231	CLIP-seq
MIRT2021713	hsa-miR-1279	CLIP-seq
MIRT2021714	hsa-miR-1292	CLIP-seq
MIRT2021715	hsa-miR-1303	CLIP-seq
MIRT1085168	hsa-miR-216a	CLIP-seq
MIRT1085170	hsa-miR-223	CLIP-seq
MIRT2021716	hsa-miR-298	CLIP-seq
MIRT1085173	hsa-miR-3140-3p	CLIP-seq
MIRT1085175	hsa-miR-3163	CLIP-seq
MIRT1085177	hsa-miR-3182	CLIP-seq
MIRT738624	hsa-miR-323-5p	CLIP-seq
MIRT2021717	hsa-miR-328	CLIP-seq
MIRT1085180	hsa-miR-340	CLIP-seq
MIRT2021718	hsa-miR-3670	CLIP-seq
MIRT2021719	hsa-miR-3691-3p	CLIP-seq
MIRT1085185	hsa-miR-371-5p	CLIP-seq
MIRT1085186	hsa-miR-371b-5p	CLIP-seq
MIRT1085189	hsa-miR-409-3p	CLIP-seq
MIRT1085190	hsa-miR-4261	CLIP-seq
MIRT2021720	hsa-miR-4282	CLIP-seq
MIRT2021721	hsa-miR-4303	CLIP-seq
MIRT1085198	hsa-miR-4328	CLIP-seq
MIRT2021722	hsa-miR-4471	CLIP-seq
MIRT1085204	hsa-miR-4503	CLIP-seq
MIRT2021723	hsa-miR-4637	CLIP-seq
MIRT2021724	hsa-miR-4652-3p	CLIP-seq
MIRT738627	hsa-miR-4666-5p	CLIP-seq
MIRT1085206	hsa-miR-4694-3p	CLIP-seq
MIRT2021725	hsa-miR-4760-3p	CLIP-seq
MIRT2021726	hsa-miR-4771	CLIP-seq
MIRT1085215	hsa-miR-4795-3p	CLIP-seq
MIRT738626	hsa-miR-4802-3p	CLIP-seq
MIRT2021727	hsa-miR-490-5p	CLIP-seq
MIRT1085216	hsa-miR-494	CLIP-seq
MIRT1085217	hsa-miR-548m	CLIP-seq
MIRT2021728	hsa-miR-549	CLIP-seq
MIRT1085220	hsa-miR-569	CLIP-seq
MIRT738625	hsa-miR-876-3p	CLIP-seq
MIRT2253218	hsa-miR-1178	CLIP-seq
MIRT1085162	hsa-miR-1231	CLIP-seq
MIRT2253219	hsa-miR-1253	CLIP-seq
MIRT2253220	hsa-miR-1290	CLIP-seq
MIRT2021714	hsa-miR-1292	CLIP-seq
MIRT2021715	hsa-miR-1303	CLIP-seq
MIRT1085165	hsa-miR-1323	CLIP-seq
MIRT2253221	hsa-miR-144	CLIP-seq
MIRT2253222	hsa-miR-18a	CLIP-seq
MIRT2253223	hsa-miR-18b	CLIP-seq
MIRT2253224	hsa-miR-203	CLIP-seq
MIRT1085170	hsa-miR-223	CLIP-seq
MIRT2253225	hsa-miR-2276	CLIP-seq
MIRT2253226	hsa-miR-2467-3p	CLIP-seq
MIRT1085172	hsa-miR-3117-3p	CLIP-seq
MIRT2253227	hsa-miR-3122	CLIP-seq
MIRT1085173	hsa-miR-3140-3p	CLIP-seq
MIRT2253228	hsa-miR-3144-5p	CLIP-seq
MIRT2253229	hsa-miR-3150a-3p	CLIP-seq
MIRT2253230	hsa-miR-3154	CLIP-seq
MIRT2253231	hsa-miR-3167	CLIP-seq
MIRT1085176	hsa-miR-3169	CLIP-seq
MIRT2253232	hsa-miR-3175	CLIP-seq
MIRT2253233	hsa-miR-3179	CLIP-seq
MIRT2253234	hsa-miR-3185	CLIP-seq
MIRT2021717	hsa-miR-328	CLIP-seq
MIRT2253235	hsa-miR-3653	CLIP-seq
MIRT2253236	hsa-miR-3658	CLIP-seq
MIRT2021718	hsa-miR-3670	CLIP-seq
MIRT2253237	hsa-miR-3675-3p	CLIP-seq
MIRT2253238	hsa-miR-3678-3p	CLIP-seq
MIRT2253239	hsa-miR-3681	CLIP-seq
MIRT1085182	hsa-miR-3682-5p	CLIP-seq
MIRT2021719	hsa-miR-3691-3p	CLIP-seq
MIRT1085187	hsa-miR-3908	CLIP-seq
MIRT2253240	hsa-miR-3913-5p	CLIP-seq
MIRT2253241	hsa-miR-3924	CLIP-seq
MIRT1085188	hsa-miR-3941	CLIP-seq
MIRT1085189	hsa-miR-409-3p	CLIP-seq
MIRT2253242	hsa-miR-421	CLIP-seq
MIRT2253243	hsa-miR-4283	CLIP-seq
MIRT2021721	hsa-miR-4303	CLIP-seq
MIRT2253244	hsa-miR-4320	CLIP-seq
MIRT1085198	hsa-miR-4328	CLIP-seq
MIRT1085199	hsa-miR-4422	CLIP-seq
MIRT2253245	hsa-miR-4424	CLIP-seq
MIRT1085200	hsa-miR-4433	CLIP-seq
MIRT2253246	hsa-miR-4434	CLIP-seq
MIRT1085201	hsa-miR-4459	CLIP-seq
MIRT2021722	hsa-miR-4471	CLIP-seq
MIRT2253247	hsa-miR-4489	CLIP-seq
MIRT1085204	hsa-miR-4503	CLIP-seq
MIRT2253248	hsa-miR-450b-3p	CLIP-seq
MIRT2253249	hsa-miR-4516	CLIP-seq
MIRT2021723	hsa-miR-4637	CLIP-seq
MIRT2253250	hsa-miR-4667-5p	CLIP-seq
MIRT1085207	hsa-miR-4695-5p	CLIP-seq
MIRT2253251	hsa-miR-4700-5p	CLIP-seq
MIRT2253252	hsa-miR-4709-5p	CLIP-seq
MIRT2253253	hsa-miR-4735-3p	CLIP-seq
MIRT1085211	hsa-miR-4759	CLIP-seq
MIRT1085213	hsa-miR-4768-3p	CLIP-seq
MIRT2021726	hsa-miR-4771	CLIP-seq
MIRT2253254	hsa-miR-4772-3p	CLIP-seq
MIRT2253255	hsa-miR-4786-3p	CLIP-seq
MIRT2253256	hsa-miR-4796-3p	CLIP-seq
MIRT2253257	hsa-miR-491-5p	CLIP-seq
MIRT2253258	hsa-miR-520d-5p	CLIP-seq
MIRT2253259	hsa-miR-520g	CLIP-seq
MIRT2253260	hsa-miR-520h	CLIP-seq
MIRT2253261	hsa-miR-524-5p	CLIP-seq
MIRT2253262	hsa-miR-544	CLIP-seq
MIRT1085218	hsa-miR-548o	CLIP-seq
MIRT2021728	hsa-miR-549	CLIP-seq
MIRT1085220	hsa-miR-569	CLIP-seq
MIRT2253263	hsa-miR-637	CLIP-seq
MIRT2253264	hsa-miR-654-3p	CLIP-seq
MIRT2253265	hsa-miR-769-3p	CLIP-seq
MIRT2253266	hsa-miR-802	CLIP-seq
MIRT2253267	hsa-miR-876-5p	CLIP-seq
MIRT2253268	hsa-miR-939	CLIP-seq
MIRT2021719	hsa-miR-3691-3p	CLIP-seq
MIRT1085161	hsa-miR-105	CLIP-seq
MIRT2556019	hsa-miR-1179	CLIP-seq
MIRT2556020	hsa-miR-1207-3p	CLIP-seq
MIRT2021712	hsa-miR-122	CLIP-seq
MIRT1085162	hsa-miR-1231	CLIP-seq
MIRT1085163	hsa-miR-1245b-5p	CLIP-seq
MIRT1085164	hsa-miR-1267	CLIP-seq
MIRT2253220	hsa-miR-1290	CLIP-seq
MIRT2556021	hsa-miR-1298	CLIP-seq
MIRT1085165	hsa-miR-1323	CLIP-seq
MIRT1922167	hsa-miR-1343	CLIP-seq
MIRT2253221	hsa-miR-144	CLIP-seq
MIRT2556022	hsa-miR-147	CLIP-seq
MIRT1085167	hsa-miR-1470	CLIP-seq
MIRT2556023	hsa-miR-204	CLIP-seq
MIRT2556024	hsa-miR-211	CLIP-seq
MIRT1085168	hsa-miR-216a	CLIP-seq
MIRT2556025	hsa-miR-2681	CLIP-seq
MIRT2021716	hsa-miR-298	CLIP-seq
MIRT2556026	hsa-miR-300	CLIP-seq
MIRT1085171	hsa-miR-3074-3p	CLIP-seq
MIRT1085172	hsa-miR-3117-3p	CLIP-seq
MIRT1085173	hsa-miR-3140-3p	CLIP-seq
MIRT1085174	hsa-miR-3142	CLIP-seq
MIRT2556027	hsa-miR-3146	CLIP-seq
MIRT2253231	hsa-miR-3167	CLIP-seq
MIRT1085176	hsa-miR-3169	CLIP-seq
MIRT1922168	hsa-miR-3192	CLIP-seq
MIRT1085178	hsa-miR-3194-3p	CLIP-seq
MIRT2021717	hsa-miR-328	CLIP-seq
MIRT2253235	hsa-miR-3653	CLIP-seq
MIRT2556028	hsa-miR-3657	CLIP-seq
MIRT2253236	hsa-miR-3658	CLIP-seq
MIRT2253237	hsa-miR-3675-3p	CLIP-seq
MIRT2253239	hsa-miR-3681	CLIP-seq
MIRT1085183	hsa-miR-3689a-3p	CLIP-seq
MIRT1085184	hsa-miR-3689c	CLIP-seq
MIRT2021719	hsa-miR-3691-3p	CLIP-seq
MIRT1085185	hsa-miR-371-5p	CLIP-seq
MIRT1085186	hsa-miR-371b-5p	CLIP-seq
MIRT2556029	hsa-miR-381	CLIP-seq
MIRT2253241	hsa-miR-3924	CLIP-seq
MIRT1085188	hsa-miR-3941	CLIP-seq
MIRT2253242	hsa-miR-421	CLIP-seq
MIRT1085191	hsa-miR-4265	CLIP-seq
MIRT1085192	hsa-miR-4275	CLIP-seq
MIRT2253243	hsa-miR-4283	CLIP-seq
MIRT1085193	hsa-miR-4286	CLIP-seq
MIRT1085194	hsa-miR-4288	CLIP-seq
MIRT1085195	hsa-miR-4296	CLIP-seq
MIRT1085196	hsa-miR-4297	CLIP-seq
MIRT1085197	hsa-miR-4322	CLIP-seq
MIRT1085199	hsa-miR-4422	CLIP-seq
MIRT1085200	hsa-miR-4433	CLIP-seq
MIRT1085201	hsa-miR-4459	CLIP-seq
MIRT2556030	hsa-miR-4464	CLIP-seq
MIRT1085202	hsa-miR-4469	CLIP-seq
MIRT2253247	hsa-miR-4489	CLIP-seq
MIRT2556031	hsa-miR-4643	CLIP-seq
MIRT2556032	hsa-miR-466	CLIP-seq
MIRT1085205	hsa-miR-4667-3p	CLIP-seq
MIRT2253250	hsa-miR-4667-5p	CLIP-seq
MIRT2556033	hsa-miR-4672	CLIP-seq
MIRT1085206	hsa-miR-4694-3p	CLIP-seq
MIRT1085207	hsa-miR-4695-5p	CLIP-seq
MIRT2556034	hsa-miR-4698	CLIP-seq
MIRT2253251	hsa-miR-4700-5p	CLIP-seq
MIRT2253252	hsa-miR-4709-5p	CLIP-seq
MIRT1085208	hsa-miR-4711-5p	CLIP-seq
MIRT2556035	hsa-miR-4714-3p	CLIP-seq
MIRT1085209	hsa-miR-4728-5p	CLIP-seq
MIRT2556036	hsa-miR-4748	CLIP-seq
MIRT1085211	hsa-miR-4759	CLIP-seq
MIRT1085213	hsa-miR-4768-3p	CLIP-seq
MIRT2556037	hsa-miR-4789-3p	CLIP-seq
MIRT2253256	hsa-miR-4796-3p	CLIP-seq
MIRT2021727	hsa-miR-490-5p	CLIP-seq
MIRT2556038	hsa-miR-511	CLIP-seq
MIRT2253258	hsa-miR-520d-5p	CLIP-seq
MIRT2253259	hsa-miR-520g	CLIP-seq
MIRT2253260	hsa-miR-520h	CLIP-seq
MIRT2253261	hsa-miR-524-5p	CLIP-seq
MIRT1085218	hsa-miR-548o	CLIP-seq
MIRT2021728	hsa-miR-549	CLIP-seq
MIRT1085219	hsa-miR-555	CLIP-seq
MIRT2556039	hsa-miR-599	CLIP-seq
MIRT1085224	hsa-miR-632	CLIP-seq
MIRT2253263	hsa-miR-637	CLIP-seq
MIRT1085226	hsa-miR-642a	CLIP-seq
MIRT2253264	hsa-miR-654-3p	CLIP-seq
MIRT2253267	hsa-miR-876-5p	CLIP-seq
MIRT2556040	hsa-miR-888	CLIP-seq
MIRT1085161	hsa-miR-105	CLIP-seq
MIRT2556019	hsa-miR-1179	CLIP-seq
MIRT2556020	hsa-miR-1207-3p	CLIP-seq
MIRT2021712	hsa-miR-122	CLIP-seq
MIRT1085162	hsa-miR-1231	CLIP-seq
MIRT1085163	hsa-miR-1245b-5p	CLIP-seq
MIRT1085164	hsa-miR-1267	CLIP-seq
MIRT2253220	hsa-miR-1290	CLIP-seq
MIRT2556021	hsa-miR-1298	CLIP-seq
MIRT1085165	hsa-miR-1323	CLIP-seq
MIRT1922167	hsa-miR-1343	CLIP-seq
MIRT2253221	hsa-miR-144	CLIP-seq
MIRT1085167	hsa-miR-1470	CLIP-seq
MIRT2556023	hsa-miR-204	CLIP-seq
MIRT2556024	hsa-miR-211	CLIP-seq
MIRT1085168	hsa-miR-216a	CLIP-seq
MIRT2556025	hsa-miR-2681	CLIP-seq
MIRT2021716	hsa-miR-298	CLIP-seq
MIRT2556026	hsa-miR-300	CLIP-seq
MIRT1085171	hsa-miR-3074-3p	CLIP-seq
MIRT1085172	hsa-miR-3117-3p	CLIP-seq
MIRT1085173	hsa-miR-3140-3p	CLIP-seq
MIRT1085174	hsa-miR-3142	CLIP-seq
MIRT2556027	hsa-miR-3146	CLIP-seq
MIRT2253231	hsa-miR-3167	CLIP-seq
MIRT1085176	hsa-miR-3169	CLIP-seq
MIRT1922168	hsa-miR-3192	CLIP-seq
MIRT1085178	hsa-miR-3194-3p	CLIP-seq
MIRT2021717	hsa-miR-328	CLIP-seq
MIRT2253235	hsa-miR-3653	CLIP-seq
MIRT2556028	hsa-miR-3657	CLIP-seq
MIRT2253236	hsa-miR-3658	CLIP-seq
MIRT2253237	hsa-miR-3675-3p	CLIP-seq
MIRT2253239	hsa-miR-3681	CLIP-seq
MIRT1085183	hsa-miR-3689a-3p	CLIP-seq
MIRT1085184	hsa-miR-3689c	CLIP-seq
MIRT2021719	hsa-miR-3691-3p	CLIP-seq
MIRT1085185	hsa-miR-371-5p	CLIP-seq
MIRT1085186	hsa-miR-371b-5p	CLIP-seq
MIRT2556029	hsa-miR-381	CLIP-seq
MIRT2253241	hsa-miR-3924	CLIP-seq
MIRT1085188	hsa-miR-3941	CLIP-seq
MIRT2253242	hsa-miR-421	CLIP-seq
MIRT2683280	hsa-miR-4255	CLIP-seq
MIRT1085191	hsa-miR-4265	CLIP-seq
MIRT1085192	hsa-miR-4275	CLIP-seq
MIRT2253243	hsa-miR-4283	CLIP-seq
MIRT1085193	hsa-miR-4286	CLIP-seq
MIRT1085194	hsa-miR-4288	CLIP-seq
MIRT1085195	hsa-miR-4296	CLIP-seq
MIRT1085196	hsa-miR-4297	CLIP-seq
MIRT1085197	hsa-miR-4322	CLIP-seq
MIRT1085199	hsa-miR-4422	CLIP-seq
MIRT1085200	hsa-miR-4433	CLIP-seq
MIRT1085201	hsa-miR-4459	CLIP-seq
MIRT1085202	hsa-miR-4469	CLIP-seq
MIRT2253247	hsa-miR-4489	CLIP-seq
MIRT2556031	hsa-miR-4643	CLIP-seq
MIRT2556032	hsa-miR-466	CLIP-seq
MIRT1085205	hsa-miR-4667-3p	CLIP-seq
MIRT2253250	hsa-miR-4667-5p	CLIP-seq
MIRT2556033	hsa-miR-4672	CLIP-seq
MIRT1085206	hsa-miR-4694-3p	CLIP-seq
MIRT1085207	hsa-miR-4695-5p	CLIP-seq
MIRT2556034	hsa-miR-4698	CLIP-seq
MIRT2253251	hsa-miR-4700-5p	CLIP-seq
MIRT2253252	hsa-miR-4709-5p	CLIP-seq
MIRT1085208	hsa-miR-4711-5p	CLIP-seq
MIRT2556035	hsa-miR-4714-3p	CLIP-seq
MIRT1085209	hsa-miR-4728-5p	CLIP-seq
MIRT1085211	hsa-miR-4759	CLIP-seq
MIRT1085213	hsa-miR-4768-3p	CLIP-seq
MIRT2556037	hsa-miR-4789-3p	CLIP-seq
MIRT2253256	hsa-miR-4796-3p	CLIP-seq
MIRT2021727	hsa-miR-490-5p	CLIP-seq
MIRT2253258	hsa-miR-520d-5p	CLIP-seq
MIRT2253259	hsa-miR-520g	CLIP-seq
MIRT2253260	hsa-miR-520h	CLIP-seq
MIRT2253261	hsa-miR-524-5p	CLIP-seq
MIRT1085218	hsa-miR-548o	CLIP-seq
MIRT2021728	hsa-miR-549	CLIP-seq
MIRT1085219	hsa-miR-555	CLIP-seq
MIRT1085224	hsa-miR-632	CLIP-seq
MIRT2253263	hsa-miR-637	CLIP-seq
MIRT1085226	hsa-miR-642a	CLIP-seq
MIRT2253264	hsa-miR-654-3p	CLIP-seq
MIRT2253267	hsa-miR-876-5p	CLIP-seq

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	9013542
GO:0000086	Process	G2/M transition of mitotic cell cycle	ISS
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IDA	24514149
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	TAS	1374686
GO:0003723	Function	RNA binding	EXP	36537190
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	1374686
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	7537265, 7852312, 9045636, 10332027, 10749975, 10913193, 11278465, 11585385, 12029088, 16107303, 16169070, 16341228, 16888650, 17141806, 17371836, 17855053, 20186123, 20936779, 21706016, 21988832, 22000517, 22365833, 22641034, 24514149, 26496610, 31413325, 31980649, 33961781, 352713
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	1374686, 29496907
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	29496907
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006397	Process	MRNA processing	IEA
GO:0006397	Process	MRNA processing	TAS	1374686
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008143	Function	Poly(A) binding	IBA
GO:0008143	Function	Poly(A) binding	IDA	21984414
GO:0008266	Function	Poly(U) RNA binding	IDA	21984414
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IDA	1374686
GO:0016020	Component	Membrane	IEA
GO:0017124	Function	SH3 domain binding	IDA	9045636
GO:0017124	Function	SH3 domain binding	IEA
GO:0019904	Function	Protein domain specific binding	IPI	10749975
GO:0031647	Process	Regulation of protein stability	IDA	21613532
GO:0032991	Component	Protein-containing complex	IDA	10332027, 10749975
GO:0035591	Function	Signaling adaptor activity	IDA	9045636
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0042169	Function	SH2 domain binding	IDA	9045636
GO:0042802	Function	Identical protein binding	IDA	10332027, 10749975
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	20186123, 22365833, 24514149, 31413325
GO:0042981	Process	Regulation of apoptotic process	IMP	36537190
GO:0043484	Process	Regulation of RNA splicing	IMP	36537190
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045948	Process	Positive regulation of translational initiation	IDA	21613532
GO:0046831	Process	Regulation of RNA export from nucleus	IEA
GO:0046831	Process	Regulation of RNA export from nucleus	ISS
GO:0046833	Process	Positive regulation of RNA export from nucleus	IDA	21613532
GO:0048024	Process	Regulation of mRNA splicing, via spliceosome	IEA
GO:0050852	Process	T cell receptor signaling pathway	IDA	9045636
GO:0051726	Process	Regulation of cell cycle	IMP	36537190
GO:0070618	Component	Grb2-Sos complex	IEA
GO:0140678	Function	Molecular function inhibitor activity	EXP	36537190
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	9045636

MIM	HGNC	e!Ensembl
602489	18116	ENSG00000121774

Q07666

Protein name

KH domain-containing, RNA-binding, signal transduction-associated protein 1 (GAP-associated tyrosine phosphoprotein p62) (Src-associated in mitosis 68 kDa protein) (Sam68) (p21 Ras GTPase-activating protein-associated p62) (p68)

Protein function

Recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-contai

PDB

2XA6 , 3QHE , 7Z89 , 7Z8A , 7Z9A , 7Z9B , 7ZAB , 7ZAC , 7ZAF , 7ZAM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16274	Qua1	102 → 153	Qua1 domain	Domain
PF00013	KH_1	157 → 227	KH domain	Domain
PF16568	Sam68-YY	366 → 415	Tyrosine-rich domain of Sam68	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in all tissue examined. Isoform 1 is expressed at lower levels in brain, skeletal muscle, and liver whereas isoform 3 is intensified in skeletal muscle and in liver. {ECO:0000269|PubMed:9013542}.

Sequence

MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPA
TQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTH
AMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQ
GNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEA
YALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPV
PRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPP
PAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTR
PSLKAPPARPVKGAYREHPYGRY

Sequence length

443

Interactions

View interactions

	Reactome
			PTK6 Regulates Proteins Involved in RNA Processing

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Premature ovarian failure	Likely pathogenic	rs750291697	RCV001270181	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (212)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	29974378, 31122822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30114705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22963397, 29897944, 31665193, 31810936		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31366900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	16405664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31090940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	19557423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28055007, 29576851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27737765, 28223223, 30235892, 31243684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22084127, 22972638, 23303844, 23417734, 23812289, 23884045, 24486447, 25114083, 25700176, 26302676, 26373655, 27016404, 27573878, 28076378, 28490746 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 2, JUVENILE (disorder)	Amyotrophic lateral sclerosis	BEFREE	20339559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28165114		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29153842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	29770139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	18273831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26732762, 29285070, 30588824, 31101336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16874300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	38287096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26732762, 29285070, 30588824, 31101336		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	30114705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	1697098		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29328391, 29556265, 31849486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29383752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25944080, 29048631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	29026317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12700667, 19718048, 19762470, 20662004, 21565971, 21766210, 23134379, 25499975, 27345399, 27758045, 28968743, 29898994, 30324661, 30417346, 31433759, 7501973 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19762470, 25913416, 26080397, 35217791, 37900073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27415018	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	7501973	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	23637164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23937454, 37900073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15926199, 17237817, 20028857, 23192274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	7501973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	7501973	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25944080, 29048631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	31050705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30793399, 31698589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27623016	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35476809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31436046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27222230, 27623016, 28498503, 29699801, 29844838, 31366900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30094720		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21700735, 29434913, 9462237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21700735, 29434913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11549587, 2574140, 25770659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	29026317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28006950, 28963374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11549587, 31183339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	19071211, 27573878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17699760, 23349811, 23421499, 25745998, 27458801, 27941883, 28903368, 30275562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27458801, 31040926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	1874294, 2200214, 24065390, 30064438, 30793399, 8461612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23937454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19755649, 27031960, 30105541, 31260889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28286740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	31501480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26350037, 30729704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	19557423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29294366, 30260594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28935571, 30401435, 31466264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24492284, 29444469, 31485651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31714914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25874492, 26162509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25874492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30306868, 30316442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex Superficialis	Epidermolysis Bullosa	BEFREE	28450279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27222230, 27623016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26050229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26050229	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28419832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28968997, 29251796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	30316442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29414645, 30873635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	30298448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	19481605, 24042580, 26373655, 28490746, 30514811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	22366791, 22674379, 22842875, 22972638, 24252525, 25185840, 27573878, 30954537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21678403, 22525272, 31037147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21678403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21678403, 22525272, 31037147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22475378, 22810421, 30387548, 31444413, 31708690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	39516455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31068419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21954231, 25311206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30026731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	29171783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29606096	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30460641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28968743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	19071211, 27573878, 31107909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myopathy, Sporadic	Inclusion body myopathy	BEFREE	19557423, 28159418, 31253480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	28076378, 28794251, 30742062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36139396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	15926199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	31802633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30094720, 7501973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29732938, 30675758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	25412696		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30498063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30498063, 31366900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	29278715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29439841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10190901, 11549587, 12118381, 21145819, 21482715, 24369267, 25026290, 2548435, 26438629, 27211490, 27246794, 27404485, 28941211, 29311600, 29961754, 30793399, 31032410, 31068419 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11549587, 31183339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	31634464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21700735, 27623016, 36082807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	26478515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	26478515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12700667, 19718048, 19762470, 20662004, 21766210, 23134379, 24626184, 25499975, 25770659, 27345399, 27758045, 28968743, 29898994, 30324661, 30417346, 31433759, 7501973 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25874492, 26162509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31810986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	31050705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11549587, 30793399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30793399, 31698589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29439841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29699801, 29844838, 31366900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21642356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15538718, 16405664, 17237817, 18273831, 18482004, 18829551, 20028857, 20110258, 23349811, 23995791, 25103771, 26310125, 28382513, 29368435, 29383752, 29634950, 31066450 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28125038, 28724634, 30231994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29328444, 29552114, 30043279, 30158521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	26707573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25944080, 29048631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10190901, 11549587, 12118381, 15972854, 16405664, 17927519, 18481990, 18483316, 18931699, 20974803, 21345143, 21565971, 22415314, 22424619, 24888590 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	26707573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21700735, 29434913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17699760, 23349811, 23421499, 25745998, 27458801, 27941883, 28903368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	29786968, 31363726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17927519, 19995069, 20663877, 25499975, 27345399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	30339727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25450268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28715145, 30581152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28966079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28715145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	29383752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	18346206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	22084127, 27016404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	23637164, 24252525, 25185840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24971696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Atrophy Spinal	Spinal muscular atrophy	Pubtator	20186123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	24618559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	BEFREE	17784878, 17931355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	26080402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11753651, 15926199, 17699760, 17927519, 1874294, 19718048, 20639695, 21565971, 21642356, 2188234, 2200214, 22415314, 22424619, 22810421, 23192274 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22917563, 26136151, 26509433, 28490746, 29535191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19071211, 19481605, 19557423, 26302676, 27573878, 28076378, 28975445, 30143980, 31818366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15926199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuronal intranuclear inclusion disease	Neuronal Intranuclear Inclusion Disease	BEFREE	31292692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22963397, 23769318, 24522888, 29793508, 30145802, 30237564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	27404485, 29276215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16517408, 28619261, 28966079, 29137239, 29251796, 30588824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	28978813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	12857745, 15765181, 16813535, 17052185, 18083707, 18481983, 18765443, 19589897, 19858527, 23417734, 24486447, 29555685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	26350037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30740681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	23018781, 28915571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Age-Related	Osteoporosis	BEFREE	16362077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24639013, 29617702, 29928361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28938739		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	29699801, 29844838, 31366900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37349576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	19589897, 23417734, 29555685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21642356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22264792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15926199, 19557423, 28840510, 30055128, 30364275, 31501480, 31818366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	31161648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31256441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36139396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	19557423, 28794251, 31253480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27107742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	28938739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	28333129, 30623621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15538718, 16405664, 17237817, 18273831, 18482004, 18829551, 20110258, 23349811, 23995791, 25103771, 26310125, 28382513, 29368435, 29383752, 29634950, 31066450 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18273831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20028857, 20110258, 26310125, 31066450, 36259569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28006950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30977401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31810986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19755649, 27031960, 30105541, 31260889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29328447		★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	31342626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29785588, 30518408, 30538709, 31205465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	33941195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	26707573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27618275, 30877875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31436046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	31436046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	28724634, 30187166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	20186123, 26438828, 29672276, 29941967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	25888134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	19788049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27706233, 28724634, 29439841, 30134604, 9462237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26050229, 29551772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24403051, 36082807, 9422082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16827128, 25714028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27473117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15926199, 25826083, 28419832, 29515134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29328444, 29552114, 30043279, 30158521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	22138392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	24618559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28966079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16843637		★★★★★ ★☆☆☆☆ Found in Text Mining only
TIBIAL MUSCULAR DYSTROPHY, TARDIVE	Tibial muscular dystrophy	BEFREE	24618559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	22638807, 23328664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	8617775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	29422639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25944080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21700735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30316442		★★★★★ ★☆☆☆☆ Found in Text Mining only

KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1)