Gene Gene information from NCBI Gene database.
Entrez ID 10655
Gene name Doublesex and mab-3 related transcription factor 2
Gene symbol DMRT2
Synonyms (NCBI Gene)
DSXL-2
Chromosome 9
Chromosome location 9p24.3
Summary The protein encoded by this gene belongs to the DMRT gene family, sharing a DM DNA-binding domain with Drosophila `doublesex` (dsx) and C. elegans mab3, genes involved in sex determination in these organisms. Also, this gene is located in a region of the
miRNA miRNA information provided by mirtarbase database.
148
miRTarBase ID miRNA Experiments Reference
MIRT019316 hsa-miR-148b-3p Microarray 17612493
MIRT719668 hsa-miR-3065-5p HITS-CLIP 19536157
MIRT719667 hsa-miR-4270 HITS-CLIP 19536157
MIRT719666 hsa-miR-4441 HITS-CLIP 19536157
MIRT719665 hsa-miR-6754-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604935 2935 ENSG00000173253
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y5R5
Protein name Doublesex- and mab-3-related transcription factor 2 (Doublesex-like 2 protein) (DSXL-2)
Protein function Transcriptional activator that directly regulates early activation of the myogenic determination gene MYF5 by binding in a sequence-specific manner to the early epaxial enhancer element of it. Involved in somitogenesis during embryogenesis and s
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00751 DM 119 165 DM DNA binding domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in testis, kidney and skeletal muscle.
Sequence
MADPQAGSAAGDWEIDVESLELEEDVCGAPRSTPPGPSPPPADGDCEDDEDDDGVDEDAE
EEGDGEEAGASPGMPGQPEQRGGPQPRPPLAPQASPAGTGPRERCTPAGGGAEPRKLSRT
PKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQ
VALRRQQATEDKKGL
SGKQNNFERKAVYQRQVRAPSLLAKSILEGYRPIPAETYVGGTFPLPPPVSDRMRKRRAF
ADKELENIMLEREYKEREMLETSQAAALFLPNRMVPGPDYNSYKSAYSPSPVEPPSKDFC
NFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPISDTLLYQQCL
LNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGH
QAVPERSAFSPPRRNFSPIVDTDSLAAQGHVLTKISKENTRHPLPLRHNPFHSLFQQTLT
DKSGPELKTPFVKEAFEETPKKHRECLVKDNQKYTFTIDRCAKDLFVAKQVGTKLSVNEP
LSFSVESILKRPSSAITRVSQ
Sequence length 561
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DMRT2-related disorder Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gonadal agenesis Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
JARCHO-LEVIN SYNDROME Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amenorrhea Amenorrhea Pubtator 36617173 Associate
★☆☆☆☆
Found in Text Mining only
Anemia, Sickle Cell Anemia BEFREE 29681102
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 28036274 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 20502531 Associate
★☆☆☆☆
Found in Text Mining only
Chronic Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 19729909
★☆☆☆☆
Found in Text Mining only
Disorder of Sex Development 46 XY 46, xy disorder of sex development Pubtator 36617173 Associate
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Esophageal squamous cell carcinoma Pubtator 24551190 Associate
★☆☆☆☆
Found in Text Mining only
Gonadal Dysgenesis Gonadal Dysgenesis BEFREE 10332030
★☆☆☆☆
Found in Text Mining only
Metabolic Syndrome Metabolic syndrome Pubtator 24504737 Associate
★☆☆☆☆
Found in Text Mining only
Obesity Obesity Pubtator 24504737 Associate
★☆☆☆☆
Found in Text Mining only