Gene Gene information from NCBI Gene database.
Entrez ID 10653
Gene name Serine peptidase inhibitor, Kunitz type 2
Gene symbol SPINT2
Synonyms (NCBI Gene)
DIAR3HAI-2HAI2KopPB
Chromosome 19
Chromosome location 19q13.2
Summary This gene encodes a transmembrane protein with two extracellular Kunitz domains that inhibits a variety of serine proteases. The protein inhibits HGF activator which prevents the formation of active hepatocyte growth factor. This gene is a putative tumor
SNPs SNP information provided by dbSNP.
7
SNP ID Visualize variation Clinical significance Consequence
rs112576957 T>A,C Pathogenic Splice donor variant
rs121908403 A>G Pathogenic Coding sequence variant, missense variant
rs121908404 A>T Pathogenic Initiator codon variant, missense variant
rs606231154 G>A Pathogenic Splice acceptor variant
rs606231155 T>C Pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
114
miRTarBase ID miRNA Experiments Reference
MIRT574111 hsa-miR-583 PAR-CLIP 20371350
MIRT574110 hsa-miR-4677-3p PAR-CLIP 20371350
MIRT574109 hsa-miR-4679 PAR-CLIP 20371350
MIRT574108 hsa-miR-3182 PAR-CLIP 20371350
MIRT574107 hsa-miR-539-5p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0001843 Process Neural tube closure IEA
GO:0004866 Function Endopeptidase inhibitor activity TAS 9115294
GO:0004867 Function Serine-type endopeptidase inhibitor activity IBA
GO:0004867 Function Serine-type endopeptidase inhibitor activity IDA 19185281, 25301953
GO:0004867 Function Serine-type endopeptidase inhibitor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605124 11247 ENSG00000167642
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O43291
Protein name Kunitz-type protease inhibitor 2 (Hepatocyte growth factor activator inhibitor type 2) (HAI-2) (Placental bikunin)
Protein function Inhibitor of HGFAC (PubMed:9346890). Also inhibits plasmin, and plasma and tissue kallikrein (PubMed:9115294). Inhibits serine protease activity of TMPRSS13 (PubMed:20977675, PubMed:28710277). Inhibits serine protease activity of ST14/matriptase
PDB 4U32
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00014 Kunitz_BPTI 37 89 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
PF00014 Kunitz_BPTI 132 184 Kunitz/Bovine pancreatic trypsin inhibitor domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in placenta, kidney, pancreas, prostate, testis, thymus, and trachea. {ECO:0000269|PubMed:9346890}.
Sequence
MAQLCGLRRSRAFLALLGSLLLSGVLAADRERSIHDFCLVSKVVGRCRASMPRWWYNVTD
GSCQLFVYGGCDGNSNNYLTKEECLKKCA
TVTENATGDLATSRNAADSSVPSAPRRQDSE
DHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACM
LRCF
RQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERALRTVWSSGD
DKEQLVKNTYVL
Sequence length 252
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    MET Receptor Activation
Signaling by MST1
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
28
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Congenital secretory sodium diarrhea 3 Likely pathogenic; Pathogenic rs2146278813, rs606231284, rs1348196809, rs606231154, rs121908403, rs606231155, rs112576957, rs121908404, rs1224874674, rs1968606914, rs780880496 RCV001779963
RCV002468935
RCV004999776
RCV002468917
RCV002468918
View all (6 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hepatocellular carcinoma Likely pathogenic rs2146278822 RCV005912618
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARCINOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acrania Acrania CTD_human_DG 24722141
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma Adenocarcinoma BEFREE 11948124
★☆☆☆☆
Found in Text Mining only
Adult Medulloblastoma Medulloblastoma BEFREE 19047176, 22447520
★☆☆☆☆
Found in Text Mining only
Anaplastic astrocytoma Anaplastic Astrocytoma BEFREE 11433397
★☆☆☆☆
Found in Text Mining only
Anaplastic carcinoma Anaplastic Carcinoma CTD_human_DG 16316942
★☆☆☆☆
Found in Text Mining only
Astrocytoma Astrocytoma BEFREE 11433397
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 14734471
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Breast neoplasm Pubtator 25786220, 26171609, 34381422 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 10695988
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Carcinoma Carcinoma CTD_human_DG 16316942
★★☆☆☆
Found in Text Mining + Unknown/Other Associations