Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10644
Gene name	Insulin like growth factor 2 mRNA binding protein 2
Gene symbol	IGF2BP2
Synonyms (NCBI Gene)	IMP-2IMP2VICKZ2
Chromosome	3
Chromosome location	3q27.2
Summary	This gene encodes a protein that binds the 5` UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative spl

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs4402960	G>T	Risk-factor	Intron variant, genic upstream transcript variant

158

Show/Hide all (158)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000792	hsa-miR-18a-5p	MicroarrayNorthern blot	16331254
MIRT005241	hsa-let-7b-5p	pSILAC	18668040
MIRT018969	hsa-miR-335-5p	Microarray	18185580
MIRT027853	hsa-miR-98-5p	Microarray	19088304
MIRT005241	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT043535	hsa-miR-331-3p	CLASH	23622248
MIRT043535	hsa-miR-331-3p	CLASH	23622248
MIRT038642	hsa-miR-125a-3p	CLASH	23622248
MIRT037361	hsa-miR-877-5p	CLASH	23622248
MIRT005241	hsa-let-7b-5p	ImmunohistochemistryLuciferase reporter assayQRTPCRWestern blot	23482325
MIRT674545	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT674544	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT674545	hsa-miR-589-3p	HITS-CLIP	23824327
MIRT674544	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT005241	hsa-let-7b-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)	38443392
MIRT1061981	hsa-miR-1256	CLIP-seq
MIRT1061982	hsa-miR-204	CLIP-seq
MIRT1061983	hsa-miR-211	CLIP-seq
MIRT1061984	hsa-miR-323-5p	CLIP-seq
MIRT1061985	hsa-miR-329	CLIP-seq
MIRT1061986	hsa-miR-362-3p	CLIP-seq
MIRT1061987	hsa-miR-3941	CLIP-seq
MIRT1061988	hsa-miR-4263	CLIP-seq
MIRT1061989	hsa-miR-4299	CLIP-seq
MIRT1061990	hsa-miR-4456	CLIP-seq
MIRT1061991	hsa-miR-4496	CLIP-seq
MIRT1061992	hsa-miR-4517	CLIP-seq
MIRT1061993	hsa-miR-4643	CLIP-seq
MIRT1061994	hsa-miR-4720-5p	CLIP-seq
MIRT1061995	hsa-miR-4738-3p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT1061997	hsa-miR-4799-3p	CLIP-seq
MIRT1061998	hsa-miR-548c-3p	CLIP-seq
MIRT1061999	hsa-miR-548q	CLIP-seq
MIRT1062000	hsa-miR-576-5p	CLIP-seq
MIRT1062001	hsa-miR-603	CLIP-seq
MIRT1062002	hsa-miR-622	CLIP-seq
MIRT1062003	hsa-miR-623	CLIP-seq
MIRT1062004	hsa-miR-876-3p	CLIP-seq
MIRT1921358	hsa-miR-2116	CLIP-seq
MIRT1921359	hsa-miR-3659	CLIP-seq
MIRT1921360	hsa-miR-3667-3p	CLIP-seq
MIRT1921361	hsa-miR-4273	CLIP-seq
MIRT1921362	hsa-miR-4446-5p	CLIP-seq
MIRT1921363	hsa-miR-4522	CLIP-seq
MIRT1921364	hsa-miR-4658	CLIP-seq
MIRT1921365	hsa-miR-4677-5p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT1921366	hsa-miR-574-5p	CLIP-seq
MIRT1921367	hsa-miR-642a	CLIP-seq
MIRT2014650	hsa-miR-4698	CLIP-seq
MIRT2014651	hsa-miR-548aa	CLIP-seq
MIRT2437723	hsa-miR-4672	CLIP-seq
MIRT2437724	hsa-miR-552	CLIP-seq
MIRT2437725	hsa-miR-640	CLIP-seq
MIRT2550464	hsa-miR-1206	CLIP-seq
MIRT1061981	hsa-miR-1256	CLIP-seq
MIRT2550465	hsa-miR-1262	CLIP-seq
MIRT2550466	hsa-miR-135a	CLIP-seq
MIRT2550467	hsa-miR-135b	CLIP-seq
MIRT1061984	hsa-miR-323-5p	CLIP-seq
MIRT2550468	hsa-miR-326	CLIP-seq
MIRT2550469	hsa-miR-330-5p	CLIP-seq
MIRT2550470	hsa-miR-34a	CLIP-seq
MIRT2550471	hsa-miR-34c-5p	CLIP-seq
MIRT1921359	hsa-miR-3659	CLIP-seq
MIRT1921360	hsa-miR-3667-3p	CLIP-seq
MIRT2550472	hsa-miR-3925-3p	CLIP-seq
MIRT1061989	hsa-miR-4299	CLIP-seq
MIRT1921362	hsa-miR-4446-5p	CLIP-seq
MIRT1061990	hsa-miR-4456	CLIP-seq
MIRT2550473	hsa-miR-449a	CLIP-seq
MIRT2550474	hsa-miR-449b	CLIP-seq
MIRT2550475	hsa-miR-4634	CLIP-seq
MIRT2550476	hsa-miR-4645-5p	CLIP-seq
MIRT1921364	hsa-miR-4658	CLIP-seq
MIRT2550477	hsa-miR-4666-5p	CLIP-seq
MIRT2437723	hsa-miR-4672	CLIP-seq
MIRT2550478	hsa-miR-4673	CLIP-seq
MIRT2550479	hsa-miR-4701-3p	CLIP-seq
MIRT2550480	hsa-miR-4712-5p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT2550481	hsa-miR-4793-5p	CLIP-seq
MIRT2550482	hsa-miR-501-5p	CLIP-seq
MIRT2550483	hsa-miR-515-5p	CLIP-seq
MIRT1061999	hsa-miR-548q	CLIP-seq
MIRT2437724	hsa-miR-552	CLIP-seq
MIRT1921366	hsa-miR-574-5p	CLIP-seq
MIRT1062002	hsa-miR-622	CLIP-seq
MIRT2437725	hsa-miR-640	CLIP-seq
MIRT1921367	hsa-miR-642a	CLIP-seq
MIRT2550484	hsa-miR-652	CLIP-seq
MIRT2550485	hsa-miR-766	CLIP-seq
MIRT2550486	hsa-miR-770-5p	CLIP-seq
MIRT1062004	hsa-miR-876-3p	CLIP-seq
MIRT2550464	hsa-miR-1206	CLIP-seq
MIRT2682649	hsa-miR-1238	CLIP-seq
MIRT1061981	hsa-miR-1256	CLIP-seq
MIRT2550465	hsa-miR-1262	CLIP-seq
MIRT2550466	hsa-miR-135a	CLIP-seq
MIRT2550467	hsa-miR-135b	CLIP-seq
MIRT2682650	hsa-miR-147b	CLIP-seq
MIRT2682651	hsa-miR-150	CLIP-seq
MIRT2682652	hsa-miR-210	CLIP-seq
MIRT2682653	hsa-miR-2113	CLIP-seq
MIRT1921358	hsa-miR-2116	CLIP-seq
MIRT2682654	hsa-miR-3183	CLIP-seq
MIRT1061984	hsa-miR-323-5p	CLIP-seq
MIRT2550468	hsa-miR-326	CLIP-seq
MIRT2682655	hsa-miR-330-3p	CLIP-seq
MIRT2550469	hsa-miR-330-5p	CLIP-seq
MIRT2550470	hsa-miR-34a	CLIP-seq
MIRT2550471	hsa-miR-34c-5p	CLIP-seq
MIRT2682656	hsa-miR-3621	CLIP-seq
MIRT2682657	hsa-miR-3656	CLIP-seq
MIRT1921359	hsa-miR-3659	CLIP-seq
MIRT1921360	hsa-miR-3667-3p	CLIP-seq
MIRT2550472	hsa-miR-3925-3p	CLIP-seq
MIRT2682658	hsa-miR-4268	CLIP-seq
MIRT1921361	hsa-miR-4273	CLIP-seq
MIRT1061989	hsa-miR-4299	CLIP-seq
MIRT2682659	hsa-miR-4428	CLIP-seq
MIRT1921362	hsa-miR-4446-5p	CLIP-seq
MIRT1061990	hsa-miR-4456	CLIP-seq
MIRT2682660	hsa-miR-4477a	CLIP-seq
MIRT2550473	hsa-miR-449a	CLIP-seq
MIRT2550474	hsa-miR-449b	CLIP-seq
MIRT1921363	hsa-miR-4522	CLIP-seq
MIRT2550475	hsa-miR-4634	CLIP-seq
MIRT2550476	hsa-miR-4645-5p	CLIP-seq
MIRT1921364	hsa-miR-4658	CLIP-seq
MIRT2550477	hsa-miR-4666-5p	CLIP-seq
MIRT2437723	hsa-miR-4672	CLIP-seq
MIRT2550478	hsa-miR-4673	CLIP-seq
MIRT1921365	hsa-miR-4677-5p	CLIP-seq
MIRT2682661	hsa-miR-4684-5p	CLIP-seq
MIRT2550479	hsa-miR-4701-3p	CLIP-seq
MIRT2550480	hsa-miR-4712-5p	CLIP-seq
MIRT2682662	hsa-miR-4723-3p	CLIP-seq
MIRT1061996	hsa-miR-4755-5p	CLIP-seq
MIRT2682663	hsa-miR-4757-5p	CLIP-seq
MIRT2682664	hsa-miR-4786-5p	CLIP-seq
MIRT2550481	hsa-miR-4793-5p	CLIP-seq
MIRT2682665	hsa-miR-4797-5p	CLIP-seq
MIRT2550482	hsa-miR-501-5p	CLIP-seq
MIRT2550483	hsa-miR-515-5p	CLIP-seq
MIRT1061999	hsa-miR-548q	CLIP-seq
MIRT2682666	hsa-miR-548u	CLIP-seq
MIRT2437724	hsa-miR-552	CLIP-seq
MIRT1921366	hsa-miR-574-5p	CLIP-seq
MIRT1062002	hsa-miR-622	CLIP-seq
MIRT2437725	hsa-miR-640	CLIP-seq
MIRT1921367	hsa-miR-642a	CLIP-seq
MIRT2550484	hsa-miR-652	CLIP-seq
MIRT2550485	hsa-miR-766	CLIP-seq
MIRT2682667	hsa-miR-769-5p	CLIP-seq
MIRT2550486	hsa-miR-770-5p	CLIP-seq
MIRT1062004	hsa-miR-876-3p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
HMGA2	Unknown	17426251;22513850
NFKB1	Unknown	17426251
RELA	Unknown	17426251

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	29476152
GO:0000932	Component	P-body	IEA
GO:0001817	Process	Regulation of cytokine production	IC	9891060
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	20080952
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	12674497, 17289661, 31484925, 32814053, 34457052, 36950384
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15618018
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15618018
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	15618018
GO:0006417	Process	Regulation of translation	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9891060
GO:0010494	Component	Cytoplasmic stress granule	IDA	29476152
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0017148	Process	Negative regulation of translation	ISS	9891060
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	36354136
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	36354136
GO:0043489	Process	RNA stabilization	IMP	36354136
GO:0045182	Function	Translation regulator activity	IEA
GO:0045182	Function	Translation regulator activity	ISS	9891060
GO:0048027	Function	MRNA 5'-UTR binding	IDA	9891060
GO:0048027	Function	MRNA 5'-UTR binding	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0070934	Process	CRD-mediated mRNA stabilization	IBA
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	29476152
GO:0070934	Process	CRD-mediated mRNA stabilization	IEA
GO:0097009	Process	Energy homeostasis	IEA
GO:0106106	Process	Cold-induced thermogenesis	IEA
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IDA	29476152, 32245947, 36354136
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IEA

MIM	HGNC	e!Ensembl
608289	28867	ENSG00000073792

Q9Y6M1

Protein name

Insulin-like growth factor 2 mRNA-binding protein 2 (IGF2 mRNA-binding protein 2) (IMP-2) (Hepatocellular carcinoma autoantigen p62) (IGF-II mRNA-binding protein 2) (VICKZ family member 2)

Protein function

RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcript

PDB

2CQH , 6ROL , 7Q98 , 7Q99

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	5 → 69	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	84 → 151	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00013	KH_1	195 → 260	KH domain	Domain
PF00013	KH_1	276 → 343	KH domain	Domain
PF00013	KH_1	429 → 494	KH domain	Domain
PF00013	KH_1	511 → 577	KH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in oocytes, granulosa cells of small and growing follicles, Leydig cells, spermatogonia and semen (at protein level). Expressed in testicular cancer (at protein level). Expressed weakly in heart, placenta, skeletal muscle, bo

Sequence

MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG
KVELHGKIMEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTET
AVVNVTYATREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQG
HAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEK
PVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKI
EHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQA
NLIPGLNLSALGIFSTGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPH
HHSYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITG
PPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTS
AEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK

Sequence length

599

Interactions

View interactions

	Reactome
			Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs) bind RNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (51)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes mellitus type 2, susceptibility to	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC POLYNEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERURICEMIC NEPHROPATHY, FAMILIAL JUVENILE 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	ClinVar, GWAS catalog ClinVar, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (125)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23421499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34705667	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31089713, 31261900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23421499, 25721883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25661373, 26416451, 30220054		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25721883, 26416451, 27733218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40137853	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32784624, 38250159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	40084251	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	30220054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25741595, 26137588, 27391348, 36289466, 36933158, 37985379, 38287808, 38320625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	31261900, 34061869, 35526050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33628845, 34420511, 35876041, 37065178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27903974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26889980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24872956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17534663, 24636221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic schizophrenia	Schizophrenia	BEFREE	23656854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic schizophrenia	Schizophrenia	PSYGENET_DG	23656854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cirrhosis	Cirrhosis	BEFREE	31555647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	38065904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23421499, 30335892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21172019, 27153315, 31230592, 31791342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21172019, 23421499, 32070145, 35014946, 35595748, 35773744, 36230970, 37194014, 37248468, 37986103, 38287808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27153315, 34659267	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	23670970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	29280852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17463249, 17534663, 22038522, 22770937, 23029108, 24898818, 25661373, 25971976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	22096510, 23364967, 33953693, 34928995, 36313769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17463249, 17534663, 22038522, 22770937, 23029108, 24898818, 25661373, 25971976		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	17463249, 18544707, 19008344, 23029108, 23403707, 23670970, 24932614, 33479058	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36457997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17463248, 17463249, 18426861, 18461161, 18469204, 18598350, 18633108, 18694974, 19008344, 19020324, 19033397, 19148120, 19228808, 19258437, 19401414 View all (30 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33390804	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22770937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	17463246, 17463248, 17463249, 18372903, 18711366, 19401414, 20581827, 21573907, 22693455, 22885922, 23300278, 23945395, 24509480, 26818947, 26961502 View all (7 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17463246, 17463248, 17463249, 18372903, 18711366, 19401414, 20581827, 20818381, 21573907, 21647700, 21874001, 22158537, 22325160, 22693455, 22885922, 23300278, 23945395, 24509480 View all (3 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17463248, 17827400, 17928989, 18162508, 18430866, 18477659, 18598350, 18633108, 18853134, 19033397, 19148120, 19258437, 19429674, 19915463, 20384434 View all (31 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37744330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22770937		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eclampsia	Eclampsia	BEFREE	29339719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34347888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27391348	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	34022433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27391348, 34022433, 36510377, 36522683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	27700103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	31209109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Malnutrition	Poor fetal nutrition	BEFREE	19258437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29163784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22899010, 27184842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25719943	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27184842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22899010, 27184842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	28901413		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	32713259, 34432221	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	23482325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	38250159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18853134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	23403707, 24959828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24636221, 24959828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	18633108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31484925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19148120, 23403707, 32784624, 33390804, 34872092	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36306790, 36608677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30513526, 37060505	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36306790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30513526		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	17426251		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	LHGDN	17426251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26426686, 29859241, 31555647, 31692433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31555647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	38287808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36257938	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32784624, 35919812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17296566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	23482325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25661373, 26416451, 30220054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24872956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31261900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28399871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17426251, 17534663, 22899010, 26416451, 28753127, 29736175, 29859241, 31804607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23421499, 30335892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35707044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	37910780	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20627640, 23418049, 24959828, 34093434	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18853134, 20627640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32784624, 38250159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23421499, 25741595, 26426686, 28753127, 28901413, 29163784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32176634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29510198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18469204, 23403707, 24062323, 25062844, 25612568, 33487124, 38065904	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	18853134, 25062844, 25612568, 31209109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33754909, 33952279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24872956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24872956, 38025760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38084732	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31261900		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31089713, 31261900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	19018773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31261900, 33082301, 34332578, 37858219, 38330578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33246429	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30247605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35293050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20142250, 27700103, 40084251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23656854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23656854		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32784624, 35129592, 35689537, 35919812, 36281789, 36416324, 37615536, 38250159, 39174693	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31209109, 31555647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28399871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33824282, 35502827, 37865637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37726690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29217458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37983610, 40137853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35894701, 36569935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36354205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	36003405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

IGF2BP2 (insulin like growth factor 2 mRNA binding protein 2)