Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10643
Gene name	Insulin like growth factor 2 mRNA binding protein 3
Gene symbol	IGF2BP3
Synonyms (NCBI Gene)	CT98IMP-3IMP3KOCKOC1VICKZ3
Chromosome	7
Chromosome location	7p15.3
Summary	The protein encoded by this gene is primarily found in the nucleolus, where it can bind to the 5` UTR of the insulin-like growth factor II leader 3 mRNA and may repress translation of insulin-like growth factor II during late development. The encoded prot

529

Show/Hide all (529)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025416	hsa-miR-34a-5p	Proteomics	21566225
MIRT025416	hsa-miR-34a-5p	Proteomics	21566225
MIRT025416	hsa-miR-34a-5p	Proteomics	21566225
MIRT026059	hsa-miR-196a-5p	Sequencing	20371350
MIRT032130	hsa-let-7d-5p	Sequencing	20371350
MIRT032297	hsa-let-7b-5p	Proteomics	18668040
MIRT051466	hsa-let-7e-5p	CLASH	23622248
MIRT045123	hsa-miR-186-5p	CLASH	23622248
MIRT045123	hsa-miR-186-5p	CLASH	23622248
MIRT044404	hsa-miR-320a	CLASH	23622248
MIRT044404	hsa-miR-320a	CLASH	23622248
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT493521	hsa-miR-378j	PAR-CLIP	20371350
MIRT493520	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT493519	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT493518	hsa-miR-5706	PAR-CLIP	20371350
MIRT026059	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547839	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547838	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT032297	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT547837	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT547836	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT547835	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051466	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT547834	hsa-miR-4500	PAR-CLIP	20371350
MIRT547833	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT547832	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT032130	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT547831	hsa-miR-4458	PAR-CLIP	20371350
MIRT372013	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT556951	hsa-miR-5195-5p	PAR-CLIP	20371350
MIRT547830	hsa-miR-544b	PAR-CLIP	20371350
MIRT547829	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT547828	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT547827	hsa-miR-4703-3p	PAR-CLIP	20371350
MIRT556950	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT556949	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT547826	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT026059	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547839	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547838	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT032297	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT547837	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT547836	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT547835	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT051466	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT547834	hsa-miR-4500	PAR-CLIP	21572407
MIRT547833	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT547832	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT032130	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT547831	hsa-miR-4458	PAR-CLIP	21572407
MIRT556951	hsa-miR-5195-5p	PAR-CLIP	21572407
MIRT547830	hsa-miR-544b	PAR-CLIP	21572407
MIRT547829	hsa-miR-7162-3p	PAR-CLIP	21572407
MIRT547828	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT547827	hsa-miR-4703-3p	PAR-CLIP	21572407
MIRT556950	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT556949	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT547826	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT026059	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547839	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547838	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT032297	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT547837	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT547836	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT547835	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT051466	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT547834	hsa-miR-4500	PAR-CLIP	21572407
MIRT547833	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT547832	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT032130	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT547831	hsa-miR-4458	PAR-CLIP	21572407
MIRT372013	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT547830	hsa-miR-544b	PAR-CLIP	21572407
MIRT547829	hsa-miR-7162-3p	PAR-CLIP	21572407
MIRT547828	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT547827	hsa-miR-4703-3p	PAR-CLIP	21572407
MIRT547826	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT493521	hsa-miR-378j	PAR-CLIP	23592263
MIRT493520	hsa-miR-6839-5p	PAR-CLIP	23592263
MIRT484635	hsa-miR-1267	PAR-CLIP	23592263
MIRT484634	hsa-miR-367-5p	PAR-CLIP	23592263
MIRT484633	hsa-miR-5191	PAR-CLIP	23592263
MIRT484632	hsa-miR-4278	PAR-CLIP	23592263
MIRT493519	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT493518	hsa-miR-5706	PAR-CLIP	23592263
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT484635	hsa-miR-1267	PAR-CLIP	23592263
MIRT484634	hsa-miR-367-5p	PAR-CLIP	23592263
MIRT484633	hsa-miR-5191	PAR-CLIP	23592263
MIRT484632	hsa-miR-4278	PAR-CLIP	23592263
MIRT475249	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT475248	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT475247	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT475246	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT475245	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT475244	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT475243	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT475242	hsa-miR-5582-3p	PAR-CLIP	23592263
MIRT475241	hsa-miR-892b	PAR-CLIP	23592263
MIRT475239	hsa-miR-4794	PAR-CLIP	23592263
MIRT475240	hsa-miR-664a-5p	PAR-CLIP	23592263
MIRT475238	hsa-miR-6069	PAR-CLIP	23592263
MIRT025416	hsa-miR-34a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28399871
MIRT025416	hsa-miR-34a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28399871
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484635	hsa-miR-1267	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484634	hsa-miR-367-5p	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484632	hsa-miR-4278	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484633	hsa-miR-5191	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	26701625
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	20371350
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	20371350
MIRT493521	hsa-miR-378j	PAR-CLIP	20371350
MIRT493520	hsa-miR-6839-5p	PAR-CLIP	20371350
MIRT484635	hsa-miR-1267	PAR-CLIP	20371350
MIRT484634	hsa-miR-367-5p	PAR-CLIP	20371350
MIRT484633	hsa-miR-5191	PAR-CLIP	20371350
MIRT484632	hsa-miR-4278	PAR-CLIP	20371350
MIRT493519	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT493518	hsa-miR-5706	PAR-CLIP	20371350
MIRT026059	hsa-miR-196a-5p	PAR-CLIP	20371350
MIRT547839	hsa-miR-196b-5p	PAR-CLIP	20371350
MIRT547838	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT032297	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT547837	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT547836	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT547835	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT051466	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT547834	hsa-miR-4500	PAR-CLIP	20371350
MIRT547833	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT547832	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT032130	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT547831	hsa-miR-4458	PAR-CLIP	20371350
MIRT372013	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT556951	hsa-miR-5195-5p	PAR-CLIP	20371350
MIRT547830	hsa-miR-544b	PAR-CLIP	20371350
MIRT547829	hsa-miR-7162-3p	PAR-CLIP	20371350
MIRT547828	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT547827	hsa-miR-4703-3p	PAR-CLIP	20371350
MIRT556950	hsa-miR-374c-5p	PAR-CLIP	20371350
MIRT556949	hsa-miR-655-3p	PAR-CLIP	20371350
MIRT547826	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT026059	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547839	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547838	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT032297	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT547837	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT547836	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT547835	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT051466	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT547834	hsa-miR-4500	PAR-CLIP	21572407
MIRT547833	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT547832	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT032130	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT547831	hsa-miR-4458	PAR-CLIP	21572407
MIRT556951	hsa-miR-5195-5p	PAR-CLIP	21572407
MIRT547830	hsa-miR-544b	PAR-CLIP	21572407
MIRT547829	hsa-miR-7162-3p	PAR-CLIP	21572407
MIRT547828	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT547827	hsa-miR-4703-3p	PAR-CLIP	21572407
MIRT556950	hsa-miR-374c-5p	PAR-CLIP	21572407
MIRT556949	hsa-miR-655-3p	PAR-CLIP	21572407
MIRT547826	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT026059	hsa-miR-196a-5p	PAR-CLIP	21572407
MIRT547839	hsa-miR-196b-5p	PAR-CLIP	21572407
MIRT547838	hsa-let-7a-5p	PAR-CLIP	21572407
MIRT032297	hsa-let-7b-5p	PAR-CLIP	21572407
MIRT547837	hsa-let-7i-5p	PAR-CLIP	21572407
MIRT547836	hsa-let-7c-5p	PAR-CLIP	21572407
MIRT547835	hsa-let-7g-5p	PAR-CLIP	21572407
MIRT051466	hsa-let-7e-5p	PAR-CLIP	21572407
MIRT547834	hsa-miR-4500	PAR-CLIP	21572407
MIRT547833	hsa-miR-98-5p	PAR-CLIP	21572407
MIRT547832	hsa-let-7f-5p	PAR-CLIP	21572407
MIRT032130	hsa-let-7d-5p	PAR-CLIP	21572407
MIRT547831	hsa-miR-4458	PAR-CLIP	21572407
MIRT372013	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT547830	hsa-miR-544b	PAR-CLIP	21572407
MIRT547829	hsa-miR-7162-3p	PAR-CLIP	21572407
MIRT547828	hsa-miR-202-3p	PAR-CLIP	21572407
MIRT547827	hsa-miR-4703-3p	PAR-CLIP	21572407
MIRT547826	hsa-miR-6869-5p	PAR-CLIP	21572407
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT493521	hsa-miR-378j	PAR-CLIP	23592263
MIRT493520	hsa-miR-6839-5p	PAR-CLIP	23592263
MIRT484635	hsa-miR-1267	PAR-CLIP	23592263
MIRT484634	hsa-miR-367-5p	PAR-CLIP	23592263
MIRT484633	hsa-miR-5191	PAR-CLIP	23592263
MIRT484632	hsa-miR-4278	PAR-CLIP	23592263
MIRT493519	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT493518	hsa-miR-5706	PAR-CLIP	23592263
MIRT484639	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484638	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484636	hsa-miR-6805-5p	PAR-CLIP	23592263
MIRT484637	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT484635	hsa-miR-1267	PAR-CLIP	23592263
MIRT484634	hsa-miR-367-5p	PAR-CLIP	23592263
MIRT484633	hsa-miR-5191	PAR-CLIP	23592263
MIRT484632	hsa-miR-4278	PAR-CLIP	23592263
MIRT475249	hsa-miR-548ae-3p	PAR-CLIP	23592263
MIRT475248	hsa-miR-548ah-3p	PAR-CLIP	23592263
MIRT475247	hsa-miR-548aj-3p	PAR-CLIP	23592263
MIRT475246	hsa-miR-548am-3p	PAR-CLIP	23592263
MIRT475245	hsa-miR-548aq-3p	PAR-CLIP	23592263
MIRT475244	hsa-miR-548j-3p	PAR-CLIP	23592263
MIRT475243	hsa-miR-548x-3p	PAR-CLIP	23592263
MIRT475242	hsa-miR-5582-3p	PAR-CLIP	23592263
MIRT475241	hsa-miR-892b	PAR-CLIP	23592263
MIRT475239	hsa-miR-4794	PAR-CLIP	23592263
MIRT475240	hsa-miR-664a-5p	PAR-CLIP	23592263
MIRT475238	hsa-miR-6069	PAR-CLIP	23592263
MIRT1062005	hsa-miR-186	CLIP-seq
MIRT1062006	hsa-miR-28-5p	CLIP-seq
MIRT1062007	hsa-miR-3139	CLIP-seq
MIRT1062008	hsa-miR-4266	CLIP-seq
MIRT1062009	hsa-miR-4473	CLIP-seq
MIRT1062010	hsa-miR-4676-5p	CLIP-seq
MIRT1062011	hsa-miR-4694-3p	CLIP-seq
MIRT1062012	hsa-miR-4705	CLIP-seq
MIRT1062013	hsa-miR-4795-3p	CLIP-seq
MIRT1062014	hsa-miR-491-3p	CLIP-seq
MIRT1062015	hsa-miR-512-3p	CLIP-seq
MIRT1062016	hsa-miR-520f	CLIP-seq
MIRT1062017	hsa-miR-522	CLIP-seq
MIRT1062018	hsa-miR-575	CLIP-seq
MIRT1062019	hsa-miR-586	CLIP-seq
MIRT1062020	hsa-miR-651	CLIP-seq
MIRT1062021	hsa-miR-708	CLIP-seq
MIRT2246595	hsa-miR-378g	CLIP-seq
MIRT2246596	hsa-miR-4422	CLIP-seq
MIRT2246597	hsa-miR-4786-5p	CLIP-seq
MIRT2246598	hsa-miR-626	CLIP-seq
MIRT2437726	hsa-miR-1254	CLIP-seq
MIRT2437727	hsa-miR-3116	CLIP-seq
MIRT2437728	hsa-miR-4423-5p	CLIP-seq
MIRT2437729	hsa-miR-4433	CLIP-seq
MIRT2437730	hsa-miR-661	CLIP-seq
MIRT2550487	hsa-miR-1226	CLIP-seq
MIRT2550488	hsa-miR-1228	CLIP-seq
MIRT2550489	hsa-miR-142-3p	CLIP-seq
MIRT2550490	hsa-miR-3152-5p	CLIP-seq
MIRT2550491	hsa-miR-320b	CLIP-seq
MIRT2550492	hsa-miR-320c	CLIP-seq
MIRT2550493	hsa-miR-320d	CLIP-seq
MIRT2550494	hsa-miR-337-3p	CLIP-seq
MIRT2550495	hsa-miR-3616-5p	CLIP-seq
MIRT2550496	hsa-miR-3617	CLIP-seq
MIRT2550497	hsa-miR-3647-5p	CLIP-seq
MIRT2550498	hsa-miR-3677-5p	CLIP-seq
MIRT2550499	hsa-miR-3688-5p	CLIP-seq
MIRT2550500	hsa-miR-4280	CLIP-seq
MIRT2550501	hsa-miR-4429	CLIP-seq
MIRT2550502	hsa-miR-4470	CLIP-seq
MIRT2550503	hsa-miR-4527	CLIP-seq
MIRT2550504	hsa-miR-4733-3p	CLIP-seq
MIRT2550505	hsa-miR-4774-3p	CLIP-seq
MIRT2550506	hsa-miR-4775	CLIP-seq
MIRT2550507	hsa-miR-4795-5p	CLIP-seq
MIRT2550508	hsa-miR-513a-3p	CLIP-seq
MIRT2550509	hsa-miR-573	CLIP-seq
MIRT2550510	hsa-miR-641	CLIP-seq
MIRT2550511	hsa-miR-943	CLIP-seq
MIRT2550489	hsa-miR-142-3p	CLIP-seq
MIRT2550494	hsa-miR-337-3p	CLIP-seq
MIRT2550495	hsa-miR-3616-5p	CLIP-seq
MIRT2550496	hsa-miR-3617	CLIP-seq
MIRT2550497	hsa-miR-3647-5p	CLIP-seq
MIRT2550498	hsa-miR-3677-5p	CLIP-seq
MIRT2550499	hsa-miR-3688-5p	CLIP-seq
MIRT2550500	hsa-miR-4280	CLIP-seq
MIRT2550502	hsa-miR-4470	CLIP-seq
MIRT2550503	hsa-miR-4527	CLIP-seq
MIRT2550507	hsa-miR-4795-5p	CLIP-seq
MIRT2550509	hsa-miR-573	CLIP-seq
MIRT2550510	hsa-miR-641	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	29476152
GO:0000932	Component	P-body	IEA
GO:0001817	Process	Regulation of cytokine production	IC	9891060
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	9891060
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	20080952
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	17289661, 32296183, 32814053, 36950384
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9891060
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9891060
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006412	Process	Translation	TAS	9891060
GO:0006417	Process	Regulation of translation	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0009653	Process	Anatomical structure morphogenesis	TAS	9891060
GO:0010494	Component	Cytoplasmic stress granule	IDA	29476152
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0017148	Process	Negative regulation of translation	ISS	9891060
GO:0045182	Function	Translation regulator activity	ISS	9891060
GO:0048027	Function	MRNA 5'-UTR binding	IDA	9891060
GO:0048027	Function	MRNA 5'-UTR binding	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0070934	Process	CRD-mediated mRNA stabilization	IBA
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	29476152
GO:0070934	Process	CRD-mediated mRNA stabilization	IEA
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IDA	29476152
GO:1990247	Function	N6-methyladenosine-containing RNA reader activity	IEA

MIM	HGNC	e!Ensembl
608259	28868	ENSG00000136231

O00425

Protein name

Insulin-like growth factor 2 mRNA-binding protein 3 (IGF2 mRNA-binding protein 3) (IMP-3) (IGF-II mRNA-binding protein 3) (KH domain-containing protein overexpressed in cancer) (hKOC) (VICKZ family member 3)

Protein function

RNA-binding factor that may recruit target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcr

PDB

2E44 , 6FQ1 , 6FQR , 6GQE , 6GX6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	4 → 69	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	83 → 150	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00013	KH_1	197 → 262	KH domain	Domain
PF00013	KH_1	278 → 345	KH domain	Domain
PF00013	KH_1	407 → 472	KH domain	Domain
PF00013	KH_1	489 → 555	KH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal liver, fetal lung, fetal kidney, fetal thymus, fetal placenta, fetal follicles of ovary and gonocytes of testis, growing oocytes, spermatogonia and semen (at protein level). Expressed in cervix adenocarcinoma, in tes

Sequence

MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGK
IELHGKPIEVEHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETA
VVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSS
RQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLK
KIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNL
QAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFV
SPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKIT
GHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK

Sequence length

579

Interactions

View interactions

	Reactome
			Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs) bind RNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic lymphocytic leukemia/small lymphocytic lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL MICROCEPHALY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary microcephaly	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular endothelial growth factor (VEGF) inhibitor response	association	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (126)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18499984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14755238, 28381175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25183049, 25886367, 27210763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	35730141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36582238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23584203, 25521223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Primary Microcephaly	Primary microcephaly	Pubtator	34402213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	16339295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34008756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28523716, 30797711, 31701672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28523716, 29847788, 30423315, 34287743, 37474008, 37705505, 37861451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35217832, 35845940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26327240, 27387388, 33297932, 34312475, 34647424, 35833147, 35963644, 37234166, 37301543, 38059827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28381175, 29212181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	38286802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20178612	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25886367, 27210763, 34061869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23465280, 25919292, 30822312, 33177247, 33628845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26782292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	LHGDN	17885673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	LHGDN	17316760, 18835627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26158423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	CTD_human_DG	23621518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34895303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22879911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22879911	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35593226, 35677634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24204606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22840368, 24204606, 35595748, 35677634, 37194014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20627640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36891946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20627640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28736533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18223334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34347888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32500232, 33872988, 34022433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	18452554, 34022433, 34054840, 38401086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	29703820, 29731738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	38341127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21649900, 28465487, 32897363, 36168628, 37309294, 37723588, 39198433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28465487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28465487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28465487, 30057315, 30762207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28465487, 28485999, 30760837, 34432221, 36761737, 37723588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	32293476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	38203769	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	37111057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	37056932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35217832	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	38048400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34793513, 35217832, 37663284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18802962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24647926, 26327240, 29679004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	17784873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17296566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	22555177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	23621518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28523716, 30797711, 31701672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28381175, 29212181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26158423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22879911, 25183049, 25216519, 25499221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22012575, 28399871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28193878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12618877, 22266872, 23812426, 25068994, 26522719, 26974154, 27210763, 28193878, 29703820, 29731738, 31309275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	12644826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18337447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30423315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22555177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	34895303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	36273157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18204432		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20483645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25380351, 31935372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	31218705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	18098206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	18098206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20627640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32760394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34894048, 37853162	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15753088, 16838325, 22012575, 22555177, 23647076, 24647926, 25183049, 26327240, 28381175, 31611984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38177154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28381175, 31611984		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	37217897	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	19192721		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26158423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19136932, 23465280, 26158423, 35616130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22879911, 25183049, 25216519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25183049, 25886367, 27210763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22879911, 33246429	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25499221, 30710069, 34332578, 34840598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal Neoplasms	CTD_human_DG	23621518		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pilocytic Astrocytoma	Astrocytoma	BEFREE	23584203, 25521223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilomyxoid astrocytoma	Pilomyxoid Astrocytoma	BEFREE	23584203, 25521223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	26974154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	26974154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32710725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32961012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18260086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	28193878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	37353558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	35845940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	21414819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23647076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31656650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37056932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22012575, 28399871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	22012575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32266868, 33437215, 36450891, 37340423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28193878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	28193878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28193878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32631391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27196766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37474008, 37743642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36732736, 38299148	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38211649, 39367493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32293476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★★★★★ ★☆☆☆☆ Found in Text Mining only

IGF2BP3 (insulin like growth factor 2 mRNA binding protein 3)