RGS14 (regulator of G protein signaling 14)

Gene

• Entrez ID: 10636
• Gene name: Regulator of G protein signaling 14
• Gene symbol: RGS14
• Synonyms (NCBI Gene): -
• Chromosome: 5
• Chromosome location: 5q35.3
• Summary: This gene encodes a member of the regulator of G-protein signaling family. This protein contains one RGS domain, two Raf-like Ras-binding domains (RBDs), and one GoLoco domain. The protein attenuates the signaling activity of G-proteins by binding, throug

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021874	hsa-miR-128-3p	Microarray	17612493
MIRT1304136	hsa-miR-3151	CLIP-seq
MIRT1304137	hsa-miR-342-5p	CLIP-seq
MIRT1304138	hsa-miR-3650	CLIP-seq
MIRT1304139	hsa-miR-3652	CLIP-seq
MIRT1304140	hsa-miR-378	CLIP-seq
MIRT1304141	hsa-miR-378b	CLIP-seq
MIRT1304142	hsa-miR-378c	CLIP-seq
MIRT1304143	hsa-miR-378d	CLIP-seq
MIRT1304144	hsa-miR-378e	CLIP-seq
MIRT1304145	hsa-miR-378f	CLIP-seq
MIRT1304146	hsa-miR-378h	CLIP-seq
MIRT1304147	hsa-miR-378i	CLIP-seq
MIRT1304148	hsa-miR-422a	CLIP-seq
MIRT1304149	hsa-miR-4430	CLIP-seq
MIRT1304150	hsa-miR-4447	CLIP-seq
MIRT1304151	hsa-miR-4455	CLIP-seq
MIRT1304152	hsa-miR-4472	CLIP-seq
MIRT1304153	hsa-miR-4492	CLIP-seq
MIRT1304154	hsa-miR-4498	CLIP-seq
MIRT1304155	hsa-miR-4651	CLIP-seq
MIRT1304156	hsa-miR-4664-5p	CLIP-seq
MIRT1304157	hsa-miR-4711-3p	CLIP-seq
MIRT1304158	hsa-miR-491-5p	CLIP-seq
MIRT1304159	hsa-miR-608	CLIP-seq
MIRT1304160	hsa-miR-762	CLIP-seq
MIRT1304161	hsa-miR-885-3p	CLIP-seq
MIRT1304136	hsa-miR-3151	CLIP-seq
MIRT1304137	hsa-miR-342-5p	CLIP-seq
MIRT1304138	hsa-miR-3650	CLIP-seq
MIRT1304150	hsa-miR-4447	CLIP-seq
MIRT1304151	hsa-miR-4455	CLIP-seq
MIRT1304152	hsa-miR-4472	CLIP-seq
MIRT1304155	hsa-miR-4651	CLIP-seq
MIRT1304156	hsa-miR-4664-5p	CLIP-seq
MIRT1304158	hsa-miR-491-5p	CLIP-seq
MIRT1304159	hsa-miR-608	CLIP-seq
MIRT1304161	hsa-miR-885-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000922	Component	Spindle pole	IEA
GO:0000922	Component	Spindle pole	ISS
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	15917656
GO:0005092	Function	GDP-dissociation inhibitor activity	IEA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	15917656
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	9168931
GO:0005515	Function	Protein binding	IPI	21044950, 21988832, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005819	Component	Spindle	IDA	15917656
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0006913	Process	Nucleocytoplasmic transport	ISS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	ISS
GO:0007051	Process	Spindle organization	IBA
GO:0007051	Process	Spindle organization	IEA
GO:0007051	Process	Spindle organization	IMP	15917656
GO:0007059	Process	Chromosome segregation	IEA
GO:0007059	Process	Chromosome segregation	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007612	Process	Learning	IEA
GO:0007612	Process	Learning	ISS
GO:0007616	Process	Long-term memory	IBA
GO:0007616	Process	Long-term memory	IEA
GO:0007616	Process	Long-term memory	ISS
GO:0008017	Function	Microtubule binding	IDA	15917656
GO:0008017	Function	Microtubule binding	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IBA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9168931
GO:0008542	Process	Visual learning	IEA
GO:0008542	Process	Visual learning	ISS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010070	Process	Zygote asymmetric cell division	IEA
GO:0010070	Process	Zygote asymmetric cell division	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0016604	Component	Nuclear body	ISS
GO:0016605	Component	PML body	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	IEA
GO:0030159	Function	Signaling receptor complex adaptor activity	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030695	Function	GTPase regulator activity	IEA
GO:0031914	Process	Negative regulation of synaptic plasticity	IEA
GO:0031914	Process	Negative regulation of synaptic plasticity	ISS
GO:0032794	Function	GTPase activating protein binding	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0045202	Component	Synapse	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	ISS
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0050769	Process	Positive regulation of neurogenesis	ISS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051301	Process	Cell division	IBA
GO:0051301	Process	Cell division	IEA
GO:0051301	Process	Cell division	IMP	17635935
GO:0060291	Process	Long-term synaptic potentiation	IBA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060291	Process	Long-term synaptic potentiation	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0098978	Component	Glutamatergic synapse	IEA

Other IDs

• MIM: 602513
• HGNC: 9996
• e!Ensembl: ENSG00000169220

Protein

• UniProt ID: O43566
• Protein name: Regulator of G-protein signaling 14 (RGS14)
• Protein function: Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Besides, modulates signal transduction
• PDB: 2JNU, 2OM2, 2XNS, 3ONW, 3QI2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00615	RGS	67 → 183	Regulator of G protein signaling domain	Domain
  PF02196	RBD	303 → 370	Raf-like Ras-binding domain	Domain
  PF02196	RBD	383 → 442	Raf-like Ras-binding domain	Domain
  PF02188	GoLoco	499 → 520	GoLoco motif	Motif

• Sequence:

  MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQP
  VASWALSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
  IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLY
  RECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPVEGPGGRPL
  RKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSTEGESESRP
  GKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQALVLDQDCT
  VLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPG
  EKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPS
  SLVKVPSSATGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSS
  EETPPQTKSAAQPIGGSLNSTTDSAL

• Sequence length: 566

Pathways

KEGG:

Rap1 signaling pathway

Reactome:

G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CALCULUS OF KIDNEY AND URETER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETEROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Chronic Kidney Diseases	Kidney Disease	BEFREE	27588450		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	26192919		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	35587600	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919, 28067908		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37988718	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	22396660, 23719187, 29577426, 31754202		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	GWASCAT_DG	26272126		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	35307350	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	31152163		★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	31365833		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	25526461	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	BEFREE	22396660, 23719187, 29577426, 31754202		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	GWASCAT_DG	22396660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	GWASDB_DG	22396660		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis	Nephrolithiasis	Pubtator	22396660, 28361944, 31754202	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrolithiasis Calcium Oxalate	Nephrolithiasis	Pubtator	31754202	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28934222		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29654651		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919, 28067908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Urolithiasis	Pubtator	28361944	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Urolithiasis	GWASCAT_DG	30975718		★★☆☆☆ Found in Text Mining + Unknown/Other Associations