POSTN (periostin)

Gene

• Entrez ID: 10631
• Gene name: Periostin
• Gene symbol: POSTN
• Synonyms (NCBI Gene): OSF-2, OSF2, PDLPOSTN, PN
• Chromosome: 13
• Chromosome location: 13q13.3
• Summary: This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesio

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT735016	hsa-miR-181a-5p	qRT-PCR	33102604
MIRT756383	hsa-miR-219a-2-3p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP)	35927233
MIRT2073911	hsa-miR-1200	CLIP-seq
MIRT2073912	hsa-miR-3140-5p	CLIP-seq
MIRT2073913	hsa-miR-4277	CLIP-seq
MIRT2597593	hsa-miR-1246	CLIP-seq
MIRT2597594	hsa-miR-1290	CLIP-seq
MIRT2597595	hsa-miR-140-3p	CLIP-seq
MIRT2597596	hsa-miR-18a	CLIP-seq
MIRT2597597	hsa-miR-18b	CLIP-seq
MIRT2597598	hsa-miR-19a	CLIP-seq
MIRT2597599	hsa-miR-19b	CLIP-seq
MIRT2597600	hsa-miR-3163	CLIP-seq
MIRT2597601	hsa-miR-33a	CLIP-seq
MIRT2597602	hsa-miR-33b	CLIP-seq
MIRT2597603	hsa-miR-3975	CLIP-seq
MIRT2597604	hsa-miR-4251	CLIP-seq
MIRT2597605	hsa-miR-4303	CLIP-seq
MIRT2597606	hsa-miR-4320	CLIP-seq
MIRT2597607	hsa-miR-4329	CLIP-seq
MIRT2597608	hsa-miR-4446-5p	CLIP-seq
MIRT2597609	hsa-miR-4459	CLIP-seq
MIRT2597610	hsa-miR-4659a-3p	CLIP-seq
MIRT2597611	hsa-miR-4659b-3p	CLIP-seq
MIRT2597612	hsa-miR-4662a-5p	CLIP-seq
MIRT2597613	hsa-miR-4676-5p	CLIP-seq
MIRT2597614	hsa-miR-4684-5p	CLIP-seq
MIRT2597615	hsa-miR-4693-3p	CLIP-seq
MIRT2597616	hsa-miR-4694-5p	CLIP-seq
MIRT2597617	hsa-miR-4695-5p	CLIP-seq
MIRT2597618	hsa-miR-4696	CLIP-seq
MIRT2597619	hsa-miR-4735-3p	CLIP-seq
MIRT2597620	hsa-miR-4755-5p	CLIP-seq
MIRT2597621	hsa-miR-4764-3p	CLIP-seq
MIRT2597622	hsa-miR-4768-5p	CLIP-seq
MIRT2597623	hsa-miR-4803	CLIP-seq
MIRT2597624	hsa-miR-518a-5p	CLIP-seq
MIRT2597625	hsa-miR-527	CLIP-seq
MIRT2597626	hsa-miR-543	CLIP-seq
MIRT2597627	hsa-miR-561	CLIP-seq
MIRT2597628	hsa-miR-575	CLIP-seq
MIRT2597629	hsa-miR-586	CLIP-seq
MIRT2597630	hsa-miR-642a	CLIP-seq
MIRT2597593	hsa-miR-1246	CLIP-seq
MIRT2597594	hsa-miR-1290	CLIP-seq
MIRT2597595	hsa-miR-140-3p	CLIP-seq
MIRT2597596	hsa-miR-18a	CLIP-seq
MIRT2597597	hsa-miR-18b	CLIP-seq
MIRT2597598	hsa-miR-19a	CLIP-seq
MIRT2597599	hsa-miR-19b	CLIP-seq
MIRT2597600	hsa-miR-3163	CLIP-seq
MIRT2597601	hsa-miR-33a	CLIP-seq
MIRT2597602	hsa-miR-33b	CLIP-seq
MIRT2597603	hsa-miR-3975	CLIP-seq
MIRT2597604	hsa-miR-4251	CLIP-seq
MIRT2597605	hsa-miR-4303	CLIP-seq
MIRT2597606	hsa-miR-4320	CLIP-seq
MIRT2597607	hsa-miR-4329	CLIP-seq
MIRT2597608	hsa-miR-4446-5p	CLIP-seq
MIRT2597609	hsa-miR-4459	CLIP-seq
MIRT2597610	hsa-miR-4659a-3p	CLIP-seq
MIRT2597611	hsa-miR-4659b-3p	CLIP-seq
MIRT2597612	hsa-miR-4662a-5p	CLIP-seq
MIRT2597613	hsa-miR-4676-5p	CLIP-seq
MIRT2597614	hsa-miR-4684-5p	CLIP-seq
MIRT2597615	hsa-miR-4693-3p	CLIP-seq
MIRT2597616	hsa-miR-4694-5p	CLIP-seq
MIRT2597617	hsa-miR-4695-5p	CLIP-seq
MIRT2597618	hsa-miR-4696	CLIP-seq
MIRT2597619	hsa-miR-4735-3p	CLIP-seq
MIRT2597620	hsa-miR-4755-5p	CLIP-seq
MIRT2597621	hsa-miR-4764-3p	CLIP-seq
MIRT2597622	hsa-miR-4768-5p	CLIP-seq
MIRT2597623	hsa-miR-4803	CLIP-seq
MIRT2597624	hsa-miR-518a-5p	CLIP-seq
MIRT2597625	hsa-miR-527	CLIP-seq
MIRT2597626	hsa-miR-543	CLIP-seq
MIRT2597627	hsa-miR-561	CLIP-seq
MIRT2597628	hsa-miR-575	CLIP-seq
MIRT2597629	hsa-miR-586	CLIP-seq
MIRT2597630	hsa-miR-642a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CDX1	Unknown	22215184
TWIST2	Unknown	21801849
YY1	Repression	21839814

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IEA
GO:0003073	Process	Regulation of systemic arterial blood pressure	IEA
GO:0005201	Function	Extracellular matrix structural constituent	RCA	20551380, 25037231, 27068509, 27559042, 28327460, 28675934
GO:0005515	Function	Protein binding	IPI	19478074
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	19478074
GO:0005802	Component	Trans-Golgi network	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IDA	12235007
GO:0007155	Process	Cell adhesion	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	ISS
GO:0008593	Process	Regulation of Notch signaling pathway	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009888	Process	Tissue development	IEA
GO:0014850	Process	Response to muscle activity	IEA
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	HDA	20551380
GO:0031012	Component	Extracellular matrix	HDA	25037231, 27068509, 27559042, 28327460, 28675934
GO:0031012	Component	Extracellular matrix	IBA
GO:0031012	Component	Extracellular matrix	IDA	18450759
GO:0031012	Component	Extracellular matrix	IEA
GO:0031012	Component	Extracellular matrix	ISS
GO:0031594	Component	Neuromuscular junction	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEA
GO:0046872	Function	Metal ion binding	IDA	18450759
GO:0050839	Function	Cell adhesion molecule binding	IBA
GO:0071307	Process	Cellular response to vitamin K	IDA	18450759
GO:0071307	Process	Cellular response to vitamin K	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IEA
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:1900025	Process	Negative regulation of substrate adhesion-dependent cell spreading	IEA
GO:1990138	Process	Neuron projection extension	IEA
GO:1990523	Process	Bone regeneration	IEA
GO:2000343	Process	Positive regulation of chemokine (C-X-C motif) ligand 2 production	IEA

Other IDs

• MIM: 608777
• HGNC: 16953
• e!Ensembl: ENSG00000133110

Protein

• UniProt ID: Q15063
• Protein name: Periostin (PN) (Osteoblast-specific factor 2) (OSF-2)
• Protein function: Induces cell attachment and spreading and plays a role in cell adhesion (PubMed:12235007). Enhances incorporation of BMP1 in the fibronectin matrix of connective tissues, and subsequent proteolytic activation of lysyl oxidase LOX (By similarity)
• PDB: 5WT7, 5YJG, 5YJH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02469	Fasciclin	109 → 232	Fasciclin domain	Domain
  PF02469	Fasciclin	245 → 367	Fasciclin domain	Domain
  PF02469	Fasciclin	379 → 494	Fasciclin domain	Domain
  PF02469	Fasciclin	507 → 630	Fasciclin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in aorta, stomach, lower gastrointestinal tract, placenta, uterus, thyroid tissue and breast. Expressed in the kidney (PubMed:21763681). Expressed in the lung (PubMed:22079858). Up-regulated in epit
• Sequence:

  MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTC
  KNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDAS
  KLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLK
  NGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDF
  IEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
  MKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHL
  IDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSM
  DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQG
  RNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDA
  FKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVND
  TLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGST
  FKEIPVTVYTTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETI
  TEVIHGEPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLKKLL
  QEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ

• Sequence length: 836

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA, ASPIRIN-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHOPULMONARY DYSPLASIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	BEFREE	16596674		★☆☆☆☆ Found in Text Mining only
Adamantinous Craniopharyngioma	Adamantinous Craniopharyngioma	BEFREE	26723972		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18443362, 18487994, 29025374		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19688273, 21855581, 31134329		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18487994		★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	26723972, 30474798		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	25503692, 31037630		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	22918213, 24759558, 28109493, 28248547, 29223720		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	28109493		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	30196986		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	22167593, 23378472		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28941122		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	19657213, 27696296, 29163770, 29945294		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31821467		★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	29391276, 30991832, 37919719	Associate	★☆☆☆☆ Found in Text Mining only
Anterior Cruciate Ligament Injuries	Anterior cruciate ligament injury	Pubtator	31430535	Stimulate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21593211	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	24260297		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21474826, 30082879		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	37773198	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	24374632	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30171335	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16815144, 17898169, 21402898, 22173721, 22227417, 23791506, 24313774, 24662806, 24759558, 26143180, 26756066, 26895432, 27484037, 27553766, 27613654, 27751727, 27939043, 28034578, 28089872, 28102057, 28128098, 28194189, 28248547, 28256388, 28355256, 28378503, 28398635, 28441982, 28511944, 28584245, 28655726, 28659663, 28918442, 28960335, 29035604, 29040053, 29054589, 29122495, 29279258, 29301585, 29316316, 29318959, 29342461, 29580282, 29648484, 29746003, 29879994, 29970479, 29981861, 30040124, 30261989, 30290132, 30308057, 30323811, 30336944, 30342583, 30450856, 30473714, 30574168, 30582493, 30612125, 30703143, 30746204, 30912328, 31012597, 31037633, 31047107, 31315668, 31391224, 31496317, 31731479, 31738608		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	17898169, 26895432, 27130294, 28659663, 36753209	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20660732, 22857879, 22918213, 23314903, 24075231, 25838094, 26143180, 28219384, 28701525, 29122495, 31012597, 31903716, 32460303, 32651123, 32907887, 33626956, 34106513, 34698372, 35550122, 36326393, 36763690, 37704583	Associate	★☆☆☆☆ Found in Text Mining only
Asthma, Aspirin-Induced	Asthma	CTD_human_DG	18391768		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Aspirin-Induced	Asthma	BEFREE	22918213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	BEFREE	30450856		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21474826, 30082879		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	21474826, 36224302	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	26261573	Associate	★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	19478074		★☆☆☆☆ Found in Text Mining only
Becker Muscular Dystrophy	Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	26967452	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	21714934, 28836852		★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	30384995		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15880581, 18097555, 21468544, 28599427		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	15880581, 18097555		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28092987		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31888563	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15273700, 16807673, 17022634, 17938160, 20560667, 20715172, 23511245, 25400079, 26225965, 26507575, 26872609, 28902360, 29161296, 29507310, 29725485, 29916127, 31572679		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17014703, 18980973, 20489157, 23056395, 24009721, 25400079, 25486483, 26872609, 29161296, 33446140, 35819135, 36190948, 37205636, 37922300	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	28471975		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	BEFREE	29122495		★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	29122495	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22363622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	CTD_human_DG	22363622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	27501402		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	36009051	Stimulate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	25781169	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25486483, 26225965, 36773295, 36813090	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11550156		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	34563225	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27458178	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	35850759	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	29161296	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15880581, 18097555, 21468544, 28599427		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11509119, 11550156, 12213217, 19688273, 23314871, 28601389, 28977942		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26716408	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29025374, 33893076, 40520021	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19781955, 33828127	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	32987711	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33124726, 35304249, 35508298	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20688362, 21670235, 24368280, 25838397, 30911061		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	30115125	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36725968	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	37939043	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28474304		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27633896, 28474304, 28902360		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29101484, 31037622		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	39182106	Associate	★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	BEFREE	31648625		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	19723327	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28668564		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30082879		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30633360		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30633360		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	27484037, 28128098		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	20096135, 22735632		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20096135, 32020235	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	29593061		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	22167593, 28536691, 28884334, 29268247, 30539653, 30890453, 31037629, 31127625		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26895432, 28511944, 29035604, 29879994		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	22173721, 22918213, 25546326, 25573836, 25674935, 28248547, 28501884, 29081260, 29754498, 29961347, 30061580, 30199582, 30746204, 31430426		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	22918213, 25060295, 28102057, 28398635, 28667737, 28842563, 28887633, 29040053, 30199582, 30935271		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29731999, 30204842		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27809916	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18443362, 19688273, 24372557, 30204842		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	15093540		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	15731169		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19212687, 26556874, 29731999		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	15731169		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19328625, 26023718, 26556874, 32049988, 32990415, 34874125, 36611136, 36773295	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	20096135, 22735632, 28693214		★☆☆☆☆ Found in Text Mining only
Congenital ectodermal dysplasia of face	Congenital Ectodermal Dysplasia Of Face	BEFREE	21801849		★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	BEFREE	16596674		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19932262, 21558869, 24219836, 25541130, 29288409		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21763681, 23896380, 28381189		★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	19478074		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	24476956	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21573804		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21573804		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	34241534	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21573804		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	26723972, 30474798		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22696470, 25060295, 28102057, 28398635, 29040053, 29665811, 30061580, 30199582, 31731479		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33737520	Associate	★☆☆☆☆ Found in Text Mining only
Cutis Laxa	Cutis Laxa	BEFREE	30574417		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	18753297, 31037629		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25383958, 26092928, 26289167, 28064223, 28064224, 28912864, 29258882, 29391276, 31430535		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	25572557		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	29604251, 31012597, 37704583, 37773198	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24412367, 24759560, 25572557, 28355256, 28631851, 28887633, 28916993, 29339444, 29604251, 30342583, 31378660, 31839780		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma	Dermatofibrosarcoma	BEFREE	28551623		★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	28551623		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28916993, 29339444, 29418037, 31037628, 31066603		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	37928522	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28639369		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28639369		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	39182106	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25884625	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29349642, 31722957		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	25884625	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	34557161	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31104272, 31722957		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	20654574, 29349642, 31037630		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	31037630		★☆☆☆☆ Found in Text Mining only
Duchenne and Becker Muscular Dystrophy	Duchenne And Becker Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	19619531	Stimulate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	37720213	Associate	★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	23378472		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24412367, 24759560, 25572557, 28355256, 28631851, 28887633, 28916993, 29339444, 29604251, 30342583, 31378660, 31839780		★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	29593061		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22471299	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22471299, 27034956, 31610174	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25759370, 27034956, 31610174		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	19079190, 24673601, 27939043, 28441982, 28584245, 28667737, 30382768, 30574168, 30746204, 30874957, 31264263		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	22857879, 27130294	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	36326393	Stimulate	★☆☆☆☆ Found in Text Mining only
Eosinophilia, Tropical	Eosinophilia	BEFREE	31012597		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	19079190, 21402898, 24220297, 25060295, 28644349, 29424023		★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	31636346, 39343172	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	30693469	Stimulate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Dystrophica	Dystrophic epidermolysis bullosa	Pubtator	35304249	Associate	★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	21508107		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	30332313, 31037629		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24368280, 25838397		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20516120		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20516120		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	20516120, 23768821, 33280513, 33543230	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	20516120, 21743296, 24551279, 27193351, 28665915, 31950035, 36813090, 38320632	Associate	★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	19079190		★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	19079190		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	37179210	Associate	★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30174940		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25003192, 28260907		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	23063503		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25467797, 25541330, 28849131		★☆☆☆☆ Found in Text Mining only
Focal Facial Dermal Dysplasias	Focal facial dermal dysplasia	Pubtator	21801849	Inhibit	★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	18434370		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	18434370		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	37907428	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	28644349		★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	24656869		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	28551623		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	36172351	Associate	★☆☆☆☆ Found in Text Mining only
Gingival Hypertrophy	Gingival Hypertrophy	BEFREE	29916554		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29411011, 31037630		★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	19145252	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21998659, 26930720, 29754406, 32510239	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23467707, 26150285, 29754406, 29774119, 30054278, 31379707, 31785437		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21998659, 29754406, 29774119, 30054278, 31379707, 31785437		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18492260, 24719188, 25140038, 37812190	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23467707, 24719188, 25735962, 27307601, 28597372, 29788550, 31540485		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	31726998, 35331167	Associate	★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	30372763		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35707463	Stimulate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35707463	Associate	★☆☆☆☆ Found in Text Mining only
Hallopeau-Siemens Disease	DYSTROPHIC EPIDERMOLYSIS BULLOSA	BEFREE	30693469		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16849536, 22952986, 29284199, 30348980		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22952986	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19932262, 21558869, 24219836, 25541130, 29288409		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24219836, 27412778, 39563337	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	31072570	Stimulate	★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	30586863		★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	20201901		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18086302		★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	37773198	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31119049		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29161296	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	28521873, 29967185		★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	35752781	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	36326393	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22403621		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	22403621		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	37939043	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19328625, 19412434, 32517742	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37180146	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30586863, 31437169		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21177844, 33905434	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22246863, 24647608, 24805851, 26756066, 28355256, 28918442, 30111332, 30174940, 31012597, 31037627, 31755669		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24647608, 24805851, 30111332, 32000779, 37907428, 37928522	Associate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	31726998		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30204842		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33737520	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	25572557		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	23453657		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28693214, 29805605		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	27633896, 28902360		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	25236364		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	21854746, 22167593, 22403621, 27920156, 28536691, 28884334, 29268247, 31037629, 31722957		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	21854746, 32517742, 37179210	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	25884625, 31726998	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	24219836	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	31726998	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30539653, 31037629		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33828127	Stimulate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	29978598, 31207579		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	19932262		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	34987094	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	36418534	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30726736		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	17060937		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17016605, 20096135, 27872089, 28119236, 28526827, 30384995, 30400797		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	26249143	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure	Liver failure	Pubtator	26249143	Associate	★☆☆☆☆ Found in Text Mining only
Localized scleroderma	Scleroderma	BEFREE	28566901		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26273833, 31012597	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27816968, 27939043		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37928522	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Obstructive	Lung disease	Pubtator	25838094	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	22246863		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19328625, 35163164, 35508298	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28088789		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35152510	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27590500		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	35967373	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17876898, 18949745, 23768821, 24551279, 26023718, 31888563, 33124726	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23056395, 28665915, 35850759	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	35965624	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	27634769		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16849536, 22952986, 29284199, 30348980		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15082792, 15273700, 16807673, 17938160, 20560667, 20715172, 23511245, 25400079, 25592291, 26225965, 26507575, 26872609, 28902360, 29507310, 29725485, 29916127, 31572679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20516120		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	14871811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28965986, 30384995		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11509119, 12213217, 19688273, 23314871, 28601389, 28977942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	17060937		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19308325, 20688362, 21670235, 26150285, 30911061		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17043657, 21225237, 27223086, 27696296, 29163770, 29945294, 31297881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19479898, 20035976, 21468544, 21714934, 23482749, 26021267, 30170989		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17876898, 21677839, 23076534, 23728938, 24418260, 25759527, 26996552, 30588108		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	24656869		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21290209		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15880581, 18097555, 21468544, 28599427		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12213217, 15880581, 18086302, 18443362, 18980973, 19308325, 19479898, 20112500, 20516120, 21225237, 21670235, 21833583, 22079858, 22166650, 22735632, 23076534, 24009721, 24418260, 24656869, 24719188, 25369801, 25592291, 25759527, 26225965, 26556874, 27307601, 27633896, 27816968, 28526827, 28884337, 28902360, 28965266, 29142596, 29805605, 29946533, 29978598, 30131847, 30348980, 30911061, 31037631, 31517399, 31812700		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30633360		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18443362, 19688273, 24372557, 30204842		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16807673, 17014703		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24009721, 25592291, 29161296		★☆☆☆☆ Found in Text Mining only
McCune-Albright Syndrome	McCune-Albright Syndrome	BEFREE	30616028		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18086302, 20489157, 24674392, 26083413, 26168233, 29498146, 30621220		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18086302		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18086302, 20489157	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	28476799		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	19781955	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	22310955		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30574417, 30978348		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	32517742	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	18086302		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	27458178	Stimulate	★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	29096644		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27322610	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	22471299, 37130146	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	17060937		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	17060937	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	24476956		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	24476956	Stimulate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	CTD_human_DG	21641384		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	18208976		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	24834847, 26926804, 28453729, 28750100, 29872491		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	38092409	Associate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22173721, 28248547, 28842563, 29040053, 29081260, 30061580, 30199582, 30746204, 30874957, 31567293		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	22918213, 25838094, 28842563, 35752781	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	25573836, 30061580, 33218117, 38280891	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16136586, 22706927, 29881294		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32271791	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11509119, 11550156, 12194119, 12213217, 14871811, 15082792, 15273700, 15880581, 16136586, 17014703, 17043657, 17408641, 17876898, 18086302, 18434370, 19212687, 19308325, 20489157, 21225237, 21290209, 21670235, 21763681, 21855581, 22079858, 22166650, 22706927, 22952986, 23314871, 23348422, 23511245, 23896380, 24009721, 24368280, 25592291, 25735962, 25759527, 26150285, 26225965, 26507575, 26982182, 26996552, 27003603, 27307601, 27633896, 27696296, 27872089, 28216224, 28551623, 28599427, 28601389, 28665915, 28884337, 28902360, 28965266, 28977942, 29142596, 29163770, 29435461, 29498146, 29514082, 29527764, 29731999, 29805605, 29881294, 29946533, 29978598, 30131847, 30170989, 30384995, 30935271, 31037631, 31037636, 31207579, 31517399		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12194119		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38451815	Associate	★☆☆☆☆ Found in Text Mining only
Neurocutaneous Syndromes	Neurocutaneous Syndromes	BEFREE	30574417		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	25113746		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	16136586		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28965986, 30474798		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11509119, 11550156, 19688273, 22079858, 23314871, 26982182, 27816968, 28088789, 28459197, 30131847, 31268191		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	28902360		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	24819376	Stimulate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30474798, 31505505, 31821467		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32517742	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	33965260	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	31051316		★☆☆☆☆ Found in Text Mining only
Osteitis Fibrosa Disseminata	Fibrous dysplasia	BEFREE	30616028		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25575966, 26289167, 28064224, 29258882, 30991832	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	26092928, 28064223		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	22215184, 28725907, 29365099, 31351195		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22215184, 29365099, 32999266, 35327993, 39940700	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22166650, 22659570		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22659570, 25224568, 27028305	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31610174	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20688362, 21670235, 30911061		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22113853, 29527764, 30448260, 31412536, 31936272, 32319226, 33317907, 36880681	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36550569	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17043657, 21225237, 27223086, 27696296, 29163770, 29945294, 31297881		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17043657		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18487994, 26844495, 31706267	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36812168	Stimulate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18434370, 29435461		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	27501402		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	22769442	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	23378472, 28624215		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	23378472	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23378472	Associate	★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	15302515		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	25400079		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	20654574, 21508107, 25355804, 25604687, 29349642		★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	29176296	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	18753297	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30332313		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	18753297, 28522687		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	18753297		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30372763		★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	30222134		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	19212687		★☆☆☆☆ Found in Text Mining only
Porphyria, Erythropoietic	Congenital erythropoietic porphyria	BEFREE	30612125		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	23791506		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	21508107, 25355804, 28913545		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	24022401, 28913545		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19479898, 20035976, 21468544, 21714934, 23482749, 26021267, 30170989		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20534149, 23273263, 23716368, 26021267, 26404961, 35887333	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25781169	Stimulate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	37179210	Inhibit	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25572557		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	37704583, 37773198	Associate	★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	17652725, 19661231, 31037630		★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31437169		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23791506	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23791506, 26895432, 30111857	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	26467509, 28256388, 30065761, 30336944, 30612125, 31012597, 31438916, 31722514		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22246863, 27435108, 28820502, 28887633, 28918442, 29498146, 30186404, 30871804, 31037627, 31505128		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	32000779	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	14871811		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21763681, 28381189		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	21854746, 28819200, 29268247, 30539653, 31037629		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	26756066, 28918442, 30548226		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	30548226		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	32517742, 35418991	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30171335		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	28248547		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	22918213	Stimulate	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33626956	Inhibit	★☆☆☆☆ Found in Text Mining only
Right ventricular failure	Ventricular Failure	BEFREE	30586863		★☆☆☆☆ Found in Text Mining only
Saethre-Chotzen Syndrome	Saethre-Chotzen Syndrome	BEFREE	29665811		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	30612125		★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	19146682	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28887633, 29339444		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	36369212	Stimulate	★☆☆☆☆ Found in Text Mining only
Scleroderma, Limited	Scleroderma	BEFREE	28916993, 31066603		★☆☆☆☆ Found in Text Mining only
Sclerosis	Sclerosis	Pubtator	23378472	Associate	★☆☆☆☆ Found in Text Mining only
Simple Pulmonary Eosinophilia	Pulmonary Eosinophilia	BEFREE	30612125		★☆☆☆☆ Found in Text Mining only
Simple renal cyst	Renal cyst	BEFREE	30332313		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	23791506		★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	Pubtator	23791506	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	25060295		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	31839780		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	32517742, 36127647	Associate	★☆☆☆☆ Found in Text Mining only
Spondylocostal dysostosis autosomal recessive	Spondylocostal dysostosis	Pubtator	22215184, 35327993	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29122495, 30655897		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20112500, 20516120, 28665915, 28693179		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17060937	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18490578, 21998657, 22952986, 31304688, 33530209, 33739025, 36691359	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16849536, 21998657, 22952986, 30348980, 31304688		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25003192, 28260907		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17876898, 21677839, 23076534, 23728938, 24418260, 25759527, 26996552, 30588108		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach Diseases	BEFREE	17876898		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17876898		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17876898, 37180146	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25486483	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	26996552, 30637809		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26996552, 34281542	Associate	★☆☆☆☆ Found in Text Mining only
Sturge-Weber Syndrome	Sturge-Weber Syndrome	BEFREE	30574417		★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28242775, 28668564, 29498090, 29855971, 30635868		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24759560, 28433542, 28887633, 29339444, 29433908		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	18097555		★☆☆☆☆ Found in Text Mining only
Telangiectasia Hereditary Hemorrhagic	Hereditary hemorrhagic telangiectasia	Pubtator	37689549	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29435461, 36120433	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21290209, 28965266		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	18434370, 21290209, 29435461		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	34563225	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23056395, 36999020, 37716956, 38631570	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25486483	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26981774	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	35850759	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33017516	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	29244110		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	36009051	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	25759527		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	24219836	Associate	★☆☆☆☆ Found in Text Mining only