Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10630
Gene name	Podoplanin
Gene symbol	PDPN
Synonyms (NCBI Gene)	AGGRUSD2-40GP36GP40Gp38HT1A-1OTS8PA2.26T1AT1A-2T1A2TI1A
Chromosome	1
Chromosome location	1p36.21
Summary	This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a di

157

Show/Hide all (157)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007320	hsa-miR-363-3p	Luciferase reporter assay	23246488
MIRT007320	hsa-miR-363-3p	Luciferase reporter assay	23246488
MIRT007320	hsa-miR-363-3p	Luciferase reporter assay	23246488
MIRT667012	hsa-miR-302f	HITS-CLIP	23706177
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT667006	hsa-miR-940	HITS-CLIP	23706177
MIRT667005	hsa-miR-3929	HITS-CLIP	23706177
MIRT667004	hsa-miR-4419b	HITS-CLIP	23706177
MIRT667003	hsa-miR-4478	HITS-CLIP	23706177
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT667000	hsa-miR-4459	HITS-CLIP	23706177
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23706177
MIRT666994	hsa-miR-1827	HITS-CLIP	23706177
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23706177
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23706177
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23706177
MIRT666985	hsa-miR-665	HITS-CLIP	23706177
MIRT667012	hsa-miR-302f	HITS-CLIP	23824327
MIRT667011	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT667010	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT667006	hsa-miR-940	HITS-CLIP	23824327
MIRT667005	hsa-miR-3929	HITS-CLIP	23824327
MIRT667004	hsa-miR-4419b	HITS-CLIP	23824327
MIRT667003	hsa-miR-4478	HITS-CLIP	23824327
MIRT667002	hsa-miR-5690	HITS-CLIP	23824327
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT667000	hsa-miR-4459	HITS-CLIP	23824327
MIRT666999	hsa-miR-4433a-3p	HITS-CLIP	23824327
MIRT666998	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23824327
MIRT666995	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT666994	hsa-miR-1827	HITS-CLIP	23824327
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT666988	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23824327
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23824327
MIRT666985	hsa-miR-665	HITS-CLIP	23824327
MIRT667012	hsa-miR-302f	HITS-CLIP	23706177
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23706177
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23706177
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23706177
MIRT667006	hsa-miR-940	HITS-CLIP	23706177
MIRT667005	hsa-miR-3929	HITS-CLIP	23706177
MIRT667004	hsa-miR-4419b	HITS-CLIP	23706177
MIRT667003	hsa-miR-4478	HITS-CLIP	23706177
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23706177
MIRT667000	hsa-miR-4459	HITS-CLIP	23706177
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23706177
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23706177
MIRT666994	hsa-miR-1827	HITS-CLIP	23706177
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23706177
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23706177
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23706177
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23706177
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23706177
MIRT666985	hsa-miR-665	HITS-CLIP	23706177
MIRT667012	hsa-miR-302f	HITS-CLIP	23824327
MIRT667011	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT667010	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT667009	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT667008	hsa-miR-6808-5p	HITS-CLIP	23824327
MIRT667007	hsa-miR-6893-5p	HITS-CLIP	23824327
MIRT667006	hsa-miR-940	HITS-CLIP	23824327
MIRT667005	hsa-miR-3929	HITS-CLIP	23824327
MIRT667004	hsa-miR-4419b	HITS-CLIP	23824327
MIRT667003	hsa-miR-4478	HITS-CLIP	23824327
MIRT667002	hsa-miR-5690	HITS-CLIP	23824327
MIRT667001	hsa-miR-4768-3p	HITS-CLIP	23824327
MIRT667000	hsa-miR-4459	HITS-CLIP	23824327
MIRT666999	hsa-miR-4433a-3p	HITS-CLIP	23824327
MIRT666998	hsa-miR-3664-3p	HITS-CLIP	23824327
MIRT666997	hsa-miR-4649-3p	HITS-CLIP	23824327
MIRT666996	hsa-miR-219b-3p	HITS-CLIP	23824327
MIRT666995	hsa-miR-3913-3p	HITS-CLIP	23824327
MIRT666994	hsa-miR-1827	HITS-CLIP	23824327
MIRT666993	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT666992	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT666991	hsa-miR-4722-5p	HITS-CLIP	23824327
MIRT666990	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT666989	hsa-miR-3140-3p	HITS-CLIP	23824327
MIRT666988	hsa-miR-489-3p	HITS-CLIP	23824327
MIRT666987	hsa-miR-514a-3p	HITS-CLIP	23824327
MIRT666986	hsa-miR-514b-3p	HITS-CLIP	23824327
MIRT666985	hsa-miR-665	HITS-CLIP	23824327
MIRT755622	hsa-miR-532-3p	Luciferase reporter assayWestern blottingqRT-PCR	34939978
MIRT1222839	hsa-miR-1185	CLIP-seq
MIRT1222840	hsa-miR-1252	CLIP-seq
MIRT1222841	hsa-miR-1265	CLIP-seq
MIRT1222842	hsa-miR-197	CLIP-seq
MIRT1222843	hsa-miR-25	CLIP-seq
MIRT1222844	hsa-miR-2682	CLIP-seq
MIRT1222845	hsa-miR-2964a-3p	CLIP-seq
MIRT1222846	hsa-miR-32	CLIP-seq
MIRT1222847	hsa-miR-330-3p	CLIP-seq
MIRT1222848	hsa-miR-3611	CLIP-seq
MIRT1222849	hsa-miR-3613-3p	CLIP-seq
MIRT1222850	hsa-miR-363	CLIP-seq
MIRT1222851	hsa-miR-367	CLIP-seq
MIRT1222852	hsa-miR-3675-3p	CLIP-seq
MIRT1222853	hsa-miR-3679-5p	CLIP-seq
MIRT1222854	hsa-miR-3691-3p	CLIP-seq
MIRT1222855	hsa-miR-3714	CLIP-seq
MIRT1222856	hsa-miR-377	CLIP-seq
MIRT1222857	hsa-miR-4484	CLIP-seq
MIRT1222858	hsa-miR-449c	CLIP-seq
MIRT1222859	hsa-miR-4509	CLIP-seq
MIRT1222860	hsa-miR-4684-5p	CLIP-seq
MIRT1222861	hsa-miR-4694-3p	CLIP-seq
MIRT1222862	hsa-miR-4731-3p	CLIP-seq
MIRT1222863	hsa-miR-4743	CLIP-seq
MIRT1222864	hsa-miR-4801	CLIP-seq
MIRT1222865	hsa-miR-548an	CLIP-seq
MIRT1222866	hsa-miR-548c-3p	CLIP-seq
MIRT1222867	hsa-miR-579	CLIP-seq
MIRT1222868	hsa-miR-92a	CLIP-seq
MIRT1222869	hsa-miR-92b	CLIP-seq
MIRT2064683	hsa-miR-150	CLIP-seq
MIRT2064684	hsa-miR-4456	CLIP-seq
MIRT2064685	hsa-miR-4713-5p	CLIP-seq
MIRT755622	hsa-miR-532-3p	CLIP-seq
MIRT2064686	hsa-miR-942	CLIP-seq
MIRT2064687	hsa-miR-4257	CLIP-seq
MIRT2292839	hsa-miR-514	CLIP-seq
MIRT2292840	hsa-miR-873	CLIP-seq
MIRT2064686	hsa-miR-942	CLIP-seq
MIRT2456159	hsa-miR-3122	CLIP-seq
MIRT1222852	hsa-miR-3675-3p	CLIP-seq
MIRT2456160	hsa-miR-3689a-3p	CLIP-seq
MIRT2456161	hsa-miR-3689c	CLIP-seq
MIRT2456162	hsa-miR-3913-5p	CLIP-seq
MIRT2456163	hsa-miR-4455	CLIP-seq
MIRT1222860	hsa-miR-4684-5p	CLIP-seq
MIRT2456164	hsa-miR-4728-5p	CLIP-seq
MIRT1222863	hsa-miR-4743	CLIP-seq
MIRT1222866	hsa-miR-548c-3p	CLIP-seq
MIRT1222852	hsa-miR-3675-3p	CLIP-seq
MIRT2456163	hsa-miR-4455	CLIP-seq
MIRT1222860	hsa-miR-4684-5p	CLIP-seq
MIRT1222863	hsa-miR-4743	CLIP-seq
MIRT1222866	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	ISS
GO:0001946	Process	Lymphangiogenesis	ISS
GO:0005102	Function	Signaling receptor binding	IDA	18215137
GO:0005372	Function	Water transmembrane transporter activity	ISS
GO:0005515	Function	Protein binding	IPI	17046996, 17616532, 18215137, 18541721, 19268462, 20962267, 25458834, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA	24275092
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	17046996, 18215137, 20962267
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	10393083
GO:0006833	Process	Water transport	ISS
GO:0006865	Process	Amino acid transport	ISS
GO:0007155	Process	Cell adhesion	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IMP	25486435
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008517	Function	Folic acid transmembrane transporter activity	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	17046996, 21376833
GO:0015171	Function	Amino acid transmembrane transporter activity	ISS
GO:0015250	Function	Water channel activity	ISS
GO:0015884	Process	Folic acid transport	ISS
GO:0016020	Component	Membrane	IDA	24275092
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IDA	14978162
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	20962267
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	ISS
GO:0019956	Function	Chemokine binding	IPI	14978162
GO:0030027	Component	Lamellipodium	IBA
GO:0030027	Component	Lamellipodium	ISS
GO:0030054	Component	Cell junction	IDA
GO:0030168	Process	Platelet activation	TAS	18215137
GO:0030175	Component	Filopodium	ISS
GO:0030324	Process	Lung development	ISS
GO:0030335	Process	Positive regulation of cell migration	IMP	21376833
GO:0031258	Component	Lamellipodium membrane	IDA	20962267
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	17046996
GO:0031527	Component	Filopodium membrane	IDA	17046996
GO:0031527	Component	Filopodium membrane	IEA
GO:0031528	Component	Microvillus membrane	IDA	17046996
GO:0031528	Component	Microvillus membrane	IEA
GO:0032587	Component	Ruffle membrane	IDA	17046996
GO:0032587	Component	Ruffle membrane	IEA
GO:0042995	Component	Cell projection	IDA	20962267
GO:0042995	Component	Cell projection	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0044319	Process	Wound healing, spreading of cells	IMP	20962267
GO:0045121	Component	Membrane raft	IDA	21376833
GO:0045121	Component	Membrane raft	IEA
GO:0048535	Process	Lymph node development	ISS
GO:0051087	Function	Protein-folding chaperone binding	IPI	23541579
GO:0060838	Process	Lymphatic endothelial cell fate commitment	ISS
GO:0061851	Component	Leading edge of lamellipodium	IDA	17046996
GO:0070161	Component	Anchoring junction	IEA
GO:0070252	Process	Actin-mediated cell contraction	ISS
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IDA	25486435
GO:0097197	Component	Tetraspanin-enriched microdomain	IDA	18541721
GO:1900024	Process	Regulation of substrate adhesion-dependent cell spreading	ISS
GO:1901731	Process	Positive regulation of platelet aggregation	IBA
GO:1901731	Process	Positive regulation of platelet aggregation	IDA	17222411, 20110424
GO:1901731	Process	Positive regulation of platelet aggregation	IMP	17616532, 18541721
GO:1904328	Process	Regulation of myofibroblast contraction	ISS
GO:2000392	Process	Regulation of lamellipodium morphogenesis	IMP	20962267

MIM	HGNC	e!Ensembl
608863	29602	ENSG00000162493

Q86YL7

Protein name

Podoplanin (Aggrus) (Glycoprotein 36) (Gp36) (PA2.26 antigen) (T1-alpha) (T1A) [Cleaved into: 29kDa cytosolic podoplanin intracellular domain (PICD)]

Protein function

Mediates effects on cell migration and adhesion through its different partners. During development plays a role in blood and lymphatic vessels separation by binding CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activa

PDB

3WSR , 4YO0 , 5XCV , 7C94 , 7CQC , 7CQD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05808	Podoplanin	28 → 161		Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in placenta, lung, skeletal muscle and brain. Weakly expressed in brain, kidney and liver. In placenta, expressed on the apical plasma membrane of endothelium. In lung, expressed in alveolar epithelium. Up-regulated in

Sequence

MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRY
KSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTT
VEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

Sequence length

162

Interactions

View interactions

	Reactome
			GPVI-mediated activation cascade

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
1P36 DELETION SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOME 1P36 DELETION SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (222)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	30515871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	29550835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18546264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20923309, 30257286, 31319967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21610106, 25388165, 25648219, 28656229, 28881047, 29290263, 29511884, 30527194, 31134329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	31452946	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	21234520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	19691459, 25820557, 27859616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	25820557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	16596424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	24526692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	30616084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	30616084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28793332, 30077780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	28793332	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21385358, 24932813, 32668112, 36208493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29476097, 34855235	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16596424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	20665731	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	31241560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24222607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	36384269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	24281769, 28073783, 36384269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	24987031, 30745334, 32479683	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone neoplasms	Bone neoplasms	BEFREE	20403045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	22394497, 26339454, 27558977, 28807983, 29676036, 29703483, 29863945, 31041803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26722465, 28073783, 29676036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	28073783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28935175, 28938000, 29374745, 29599311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25744065, 28416768, 28938000, 30173230, 37744272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	31208371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	29719198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30654768, 35625534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16616332, 27859616, 29374745, 30616084, 31300272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21423152, 22580922, 24804195, 31452946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	2366004	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28348421, 28871005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24222607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27840987, 28642617, 28881047, 29872344, 30254454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24354864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27389969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16006773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16415794, 19681903, 21340215, 22790409, 23817087, 25197355, 26700593, 28059107, 28086225, 28656229, 32684738, 33457092, 35264072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31688008, 7506776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	CTD_human_DG	22784439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24354864, 28982860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	24454898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28912668, 29458011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	31502345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28912668, 29458011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29391878, 30476924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondroblastoma	Chondroblastoma	BEFREE	20403045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	LHGDN	18820665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	18820665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	20403045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	18820665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	20403045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	16718353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	19550098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	23812230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17882649, 19556810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14522983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16006773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19276682, 24015033, 29162097, 37369175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27389969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31351471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31270434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	23047035, 35625534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	28982860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	34274346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	23300922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	31578434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encapsulating Peritoneal Sclerosis	Encapsulating Peritoneal Sclerosis	BEFREE	23300922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	23812230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	26808132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24938315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24938315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32684738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21939555, 24103048, 24966946, 25197355, 26095281, 26464673, 26722465, 27035755, 27987372, 28086225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	24797369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	22588067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22830405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	16718353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	40084998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	34855235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16596424, 20665731, 26190195, 28642617, 30418623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20665731, 34713474, 37434432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16596424, 20665731, 26190195, 30418623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18492260, 26339454, 36434176, 40554484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22394497, 24771584, 26339454, 29676036, 30948364, 30972297, 31100523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31300272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	31967978, 35880270, 39619326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	14559986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	LHGDN	18650031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	10027397, 22067331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	35474271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31270434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	22790409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28416768	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27313177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	27153448, 29588189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24354864, 28386369, 28702871, 28982860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10068212, 14559986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	29414392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25920588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	20196862	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27035421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29550835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27035421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	27153448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	27153448, 28123562, 29588189, 30638740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	19773378, 28123562, 29496040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	21234520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	21234520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28348421, 28871005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	21059220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26700593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29863945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	LHGDN	17377811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioma	Lymphangioma	BEFREE	14559986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16394285, 20923309, 25119595, 26700593, 28702871, 34939978, 35880270, 37369175, 37744272, 37955536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	LHGDN	16528371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16528371	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16804930, 24966946, 28423532, 32384443	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29409810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	40130551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	26339454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31300272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	22784439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	30801908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	28807983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28935175, 28938000, 29374745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24938315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27840987, 28642617, 28881047, 29872344, 30254454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	19773378, 28123562, 29496040, 29649929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	31208371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	8242637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24354864, 28702871, 30476924, 31570451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31688008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17230534, 29715091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24797369, 30654768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	29765527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24222607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12851706, 16596424, 17944973, 19031946, 19146981, 19556810, 20066519, 20616339, 20923309, 20962267, 21034514, 22394497, 22580922, 24222607, 24354864 View all (40 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28912668, 29458011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16142411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18165897		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29575529, 31208371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	16056246, 16415794, 23041828, 32260559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	18162779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23291918, 27840987, 30801908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	32260559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	25098985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	16804930, 19773378, 22081310, 23047035, 25119595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	27545193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31208371, 31321241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	31321241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10068212, 16142411, 16596424, 18657337, 19031946, 19146981, 19556810, 19691459, 20616339, 20855662, 20923309, 21034514, 21234520, 21610106, 21939555 View all (55 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	25920588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22588067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25388165, 30527194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	25857300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	19691459, 25820557, 29577431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	35256682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20403045, 31778548, 31807157, 31808911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32479683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25803614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24354864, 28702871, 30476924, 31570451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28702871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	30515871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24797369, 29100400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	30656679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal fibrosis	Pubtator	23300922	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal Neoplasms	CTD_human_DG	22784439		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	30460511, 30736372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	30821336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	38506416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28839100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	28222099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24932813, 30736372, 31275320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	36946268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	23774169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	24067801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	31688008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	16006773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	LHGDN	17951198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29269852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	29773597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	28182302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	23812230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	31688008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25909164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	21234520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15515019, 18657337, 19031946, 22859271, 23266472, 23541579, 23817087, 24103048, 24938315, 27232357, 27437903, 27628318, 28011493, 28059107, 28086225 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15515019, 18539139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20066519, 21939555, 24938315, 27035755, 27987372, 28086225, 28818096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20196862, 23047035, 23817087, 24281769, 25098985, 25119595, 25197355, 26960495, 29719198, 31508790, 33237234, 34939978, 35880270, 36077194, 37993428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22081310	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	27628318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28011493, 28656229, 28881047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	27437903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	27859466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23246488, 26081937, 27437903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	20066519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17230534, 29715091, 31703077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23238856, 31703077, 32384443, 33235820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	34855235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	16006773	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	Pubtator	28073783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	BEFREE	29703483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	26808132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	24797369, 26715280, 30654768, 37955536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	24797369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24797369, 30654768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24797369, 30654768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24797369, 30654768, 37955536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	16804930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25667103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16528371, 21340215, 35264072	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31001140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	28073783	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	29676036, 36384269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PDPN (podoplanin)