TXNIP (thioredoxin interacting protein)

Gene

• Entrez ID: 10628
• Gene name: Thioredoxin interacting protein
• Gene symbol: TXNIP
• Synonyms (NCBI Gene): ARRDC6, EST01027, HHCPA78, THIF, VDUP1
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: This gene encodes a thioredoxin-binding protein that is a member of the alpha arrestin protein family. Thioredoxin is a thiol-oxidoreductase that is a major regulator of cellular redox signaling which protects cells from oxidative stress. This protein inh

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005561	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21271679
MIRT019486	hsa-miR-148b-3p	Microarray	17612493
MIRT022063	hsa-miR-128-3p	Microarray	17612493
MIRT025014	hsa-miR-183-5p	Sequencing	20371350
MIRT025554	hsa-miR-34a-5p	Sequencing	20371350
MIRT043886	hsa-miR-378a-3p	CLASH	23622248
MIRT054148	hsa-miR-372-3p	Microarray, qRT-PCR	22660396
MIRT130120	hsa-miR-520b	PAR-CLIP	20371350
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT005561	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT054148	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT130113	hsa-miR-520e	PAR-CLIP	20371350
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT130159	hsa-miR-302e	PAR-CLIP	20371350
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT130067	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT130070	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT130091	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT130105	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT130073	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT130118	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT130124	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT130075	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561377	hsa-miR-3609	PAR-CLIP	20371350
MIRT561378	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561376	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT561375	hsa-miR-4511	PAR-CLIP	20371350
MIRT130192	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT130120	hsa-miR-520b	PAR-CLIP	20371350
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT005561	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT054148	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT130113	hsa-miR-520e	PAR-CLIP	20371350
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT130159	hsa-miR-302e	PAR-CLIP	20371350
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT180554	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT180553	hsa-miR-17-3p	PAR-CLIP	20371350
MIRT180560	hsa-miR-6868-5p	PAR-CLIP	20371350
MIRT246181	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT246175	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT500628	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT500627	hsa-miR-5194	PAR-CLIP	20371350
MIRT500626	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT500625	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	20371350
MIRT180555	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT246196	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT246198	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT180559	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT500622	hsa-miR-1202	PAR-CLIP	20371350
MIRT561377	hsa-miR-3609	PAR-CLIP	20371350
MIRT561378	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561376	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT561375	hsa-miR-4511	PAR-CLIP	20371350
MIRT130131	hsa-miR-499a-3p	PAR-CLIP	20371350
MIRT130199	hsa-miR-499b-3p	PAR-CLIP	20371350
MIRT130192	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT571581	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT571580	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT505261	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT059163	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT505260	hsa-miR-4539	PAR-CLIP	20371350
MIRT059166	hsa-miR-3689d	PAR-CLIP	20371350
MIRT059169	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT025554	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT130094	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT130106	hsa-miR-449a	PAR-CLIP	20371350
MIRT130146	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT130215	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT059164	hsa-miR-152-5p	PAR-CLIP	20371350
MIRT059165	hsa-miR-4443	PAR-CLIP	20371350
MIRT059167	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT565132	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT565131	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT565130	hsa-miR-5688	PAR-CLIP	20371350
MIRT266194	hsa-miR-1273d	PAR-CLIP	20371350
MIRT266193	hsa-miR-101-5p	PAR-CLIP	20371350
MIRT565129	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT565128	hsa-miR-4682	PAR-CLIP	20371350
MIRT332871	hsa-miR-2861	PAR-CLIP	20371350
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT130148	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT130171	hsa-miR-4295	PAR-CLIP	20371350
MIRT130176	hsa-miR-3666	PAR-CLIP	20371350
MIRT130095	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT130097	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT130152	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT130081	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT130181	hsa-miR-548aa	PAR-CLIP	20371350
MIRT130205	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT130165	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT130231	hsa-miR-6826-5p	PAR-CLIP	20371350
MIRT130206	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT130241	hsa-miR-8060	PAR-CLIP	20371350
MIRT130123	hsa-miR-519d-5p	PAR-CLIP	20371350
MIRT130162	hsa-miR-2116-3p	PAR-CLIP	20371350
MIRT130164	hsa-miR-3119	PAR-CLIP	20371350
MIRT500633	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT130194	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT500632	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT130236	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT505261	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT059163	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT505260	hsa-miR-4539	PAR-CLIP	20371350
MIRT059166	hsa-miR-3689d	PAR-CLIP	20371350
MIRT059169	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT025554	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT130094	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT130106	hsa-miR-449a	PAR-CLIP	20371350
MIRT130146	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT130215	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT059164	hsa-miR-152-5p	PAR-CLIP	20371350
MIRT059165	hsa-miR-4443	PAR-CLIP	20371350
MIRT059167	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT130120	hsa-miR-520b	PAR-CLIP	20371350
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT005561	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT054148	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT130113	hsa-miR-520e	PAR-CLIP	20371350
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT130159	hsa-miR-302e	PAR-CLIP	20371350
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT130067	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT130070	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT130091	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT130105	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT130073	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT130118	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT130124	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT130075	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561377	hsa-miR-3609	PAR-CLIP	20371350
MIRT561378	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561376	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT561375	hsa-miR-4511	PAR-CLIP	20371350
MIRT130131	hsa-miR-499a-3p	PAR-CLIP	20371350
MIRT130199	hsa-miR-499b-3p	PAR-CLIP	20371350
MIRT130192	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT130120	hsa-miR-520b	PAR-CLIP	21572407
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT005561	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT054148	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT130113	hsa-miR-520e	PAR-CLIP	21572407
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT130159	hsa-miR-302e	PAR-CLIP	21572407
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT246191	hsa-miR-5586-3p	PAR-CLIP	21572407
MIRT180554	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT130149	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT246195	hsa-miR-6761-5p	PAR-CLIP	21572407
MIRT246187	hsa-miR-4513	PAR-CLIP	21572407
MIRT246200	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT500629	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT246188	hsa-miR-4693-3p	PAR-CLIP	21572407
MIRT246177	hsa-miR-1236-5p	PAR-CLIP	21572407
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	21572407
MIRT246172	hsa-miR-134-5p	PAR-CLIP	21572407
MIRT246178	hsa-miR-3118	PAR-CLIP	21572407
MIRT246179	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT246186	hsa-miR-4439	PAR-CLIP	21572407
MIRT130135	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	22012620
MIRT130089	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT130232	hsa-miR-6832-3p	PAR-CLIP	22012620
MIRT130143	hsa-miR-623	PAR-CLIP	22012620
MIRT130078	hsa-miR-204-5p	PAR-CLIP	22012620
MIRT130079	hsa-miR-211-5p	PAR-CLIP	22012620
MIRT533399	hsa-miR-548s	PAR-CLIP	22012620
MIRT130193	hsa-miR-4701-5p	PAR-CLIP	22012620
MIRT130138	hsa-miR-588	PAR-CLIP	22012620
MIRT533398	hsa-miR-4435	PAR-CLIP	22012620
MIRT533397	hsa-miR-3187-3p	PAR-CLIP	22012620
MIRT130197	hsa-miR-4755-5p	PAR-CLIP	22012620
MIRT130203	hsa-miR-5006-3p	PAR-CLIP	22012620
MIRT130186	hsa-miR-4446-5p	PAR-CLIP	22012620
MIRT332889	hsa-miR-3126-3p	PAR-CLIP	22012620
MIRT332886	hsa-miR-1298-3p	PAR-CLIP	22012620
MIRT533396	hsa-miR-29b-1-5p	PAR-CLIP	22012620
MIRT130120	hsa-miR-520b	PAR-CLIP	23446348
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT005561	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT054148	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT130113	hsa-miR-520e	PAR-CLIP	23446348
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT130159	hsa-miR-302e	PAR-CLIP	23446348
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT180554	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT180553	hsa-miR-17-3p	PAR-CLIP	23446348
MIRT180560	hsa-miR-6868-5p	PAR-CLIP	23446348
MIRT246181	hsa-miR-3184-5p	PAR-CLIP	23446348
MIRT246175	hsa-miR-423-5p	PAR-CLIP	23446348
MIRT500628	hsa-miR-1914-3p	PAR-CLIP	23446348
MIRT500627	hsa-miR-5194	PAR-CLIP	23446348
MIRT500626	hsa-miR-6738-5p	PAR-CLIP	23446348
MIRT500625	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	23446348
MIRT180555	hsa-miR-885-3p	PAR-CLIP	23446348
MIRT246196	hsa-miR-6762-5p	PAR-CLIP	23446348
MIRT246198	hsa-miR-6845-5p	PAR-CLIP	23446348
MIRT180559	hsa-miR-6734-5p	PAR-CLIP	23446348
MIRT500622	hsa-miR-1202	PAR-CLIP	23446348
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	23446348
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	23446348
MIRT130148	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT130171	hsa-miR-4295	PAR-CLIP	23446348
MIRT130176	hsa-miR-3666	PAR-CLIP	23446348
MIRT130095	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT130097	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT130152	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT130081	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT130076	hsa-miR-148a-3p	PAR-CLIP	23446348
MIRT130085	hsa-miR-152-3p	PAR-CLIP	23446348
MIRT019486	hsa-miR-148b-3p	PAR-CLIP	23446348
MIRT130181	hsa-miR-548aa	PAR-CLIP	23446348
MIRT130205	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT130165	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT332866	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT130231	hsa-miR-6826-5p	PAR-CLIP	23446348
MIRT130206	hsa-miR-5196-3p	PAR-CLIP	23446348
MIRT130123	hsa-miR-519d-5p	PAR-CLIP	23446348
MIRT130162	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT500632	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT130236	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT022063	hsa-miR-128-3p	PAR-CLIP	23446348
MIRT059145	hsa-miR-216a-3p	PAR-CLIP	23446348
MIRT059154	hsa-miR-3681-3p	PAR-CLIP	23446348
MIRT059146	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT180547	hsa-miR-3929	PAR-CLIP	23446348
MIRT180549	hsa-miR-4419b	PAR-CLIP	23446348
MIRT180548	hsa-miR-4478	PAR-CLIP	23446348
MIRT059148	hsa-miR-335-5p	PAR-CLIP	23446348
MIRT180544	hsa-miR-194-3p	PAR-CLIP	23446348
MIRT059158	hsa-miR-5193	PAR-CLIP	23446348
MIRT059151	hsa-miR-660-3p	PAR-CLIP	23446348
MIRT505267	hsa-miR-212-5p	PAR-CLIP	23446348
MIRT059152	hsa-miR-3189-3p	PAR-CLIP	23446348
MIRT505266	hsa-miR-4304	PAR-CLIP	23446348
MIRT505265	hsa-miR-2277-3p	PAR-CLIP	23446348
MIRT180551	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT180552	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT505264	hsa-miR-629-5p	PAR-CLIP	23446348
MIRT059153	hsa-miR-4326	PAR-CLIP	23446348
MIRT059144	hsa-miR-27a-3p	PAR-CLIP	23446348
MIRT059147	hsa-miR-27b-3p	PAR-CLIP	23446348
MIRT059157	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT059161	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT059159	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT505263	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT505262	hsa-miR-573	PAR-CLIP	23446348
MIRT059155	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT059156	hsa-miR-4507	PAR-CLIP	23446348
MIRT059162	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT505261	hsa-miR-5002-5p	PAR-CLIP	23446348
MIRT059163	hsa-miR-16-1-3p	PAR-CLIP	23446348
MIRT505260	hsa-miR-4539	PAR-CLIP	23446348
MIRT059166	hsa-miR-3689d	PAR-CLIP	23446348
MIRT059169	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT025554	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT130094	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT130106	hsa-miR-449a	PAR-CLIP	23446348
MIRT130146	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT130215	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT059164	hsa-miR-152-5p	PAR-CLIP	23446348
MIRT059165	hsa-miR-4443	PAR-CLIP	23446348
MIRT059167	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT464927	hsa-miR-18a-5p	PAR-CLIP	24398324
MIRT464926	hsa-miR-18b-5p	PAR-CLIP	24398324
MIRT464924	hsa-miR-4735-3p	PAR-CLIP	24398324
MIRT464925	hsa-miR-323a-3p	PAR-CLIP	24398324
MIRT266189	hsa-miR-4476	PAR-CLIP	24398324
MIRT266192	hsa-miR-6876-5p	PAR-CLIP	24398324
MIRT464923	hsa-miR-6847-5p	PAR-CLIP	24398324
MIRT464922	hsa-miR-4257	PAR-CLIP	24398324
MIRT464921	hsa-miR-1180-5p	PAR-CLIP	24398324
MIRT464920	hsa-miR-7114-3p	PAR-CLIP	24398324
MIRT266191	hsa-miR-3975	PAR-CLIP	24398324
MIRT464919	hsa-miR-711	PAR-CLIP	24398324
MIRT464918	hsa-miR-8071	PAR-CLIP	24398324
MIRT464917	hsa-miR-4800-5p	PAR-CLIP	24398324
MIRT464916	hsa-miR-155-3p	PAR-CLIP	24398324
MIRT130148	hsa-miR-454-3p	PAR-CLIP	24398324
MIRT130171	hsa-miR-4295	PAR-CLIP	24398324
MIRT130176	hsa-miR-3666	PAR-CLIP	24398324
MIRT130095	hsa-miR-301a-3p	PAR-CLIP	24398324
MIRT130097	hsa-miR-130b-3p	PAR-CLIP	24398324
MIRT130152	hsa-miR-301b-3p	PAR-CLIP	24398324
MIRT130081	hsa-miR-130a-3p	PAR-CLIP	24398324
MIRT130181	hsa-miR-548aa	PAR-CLIP	24398324
MIRT130205	hsa-miR-548ap-3p	PAR-CLIP	24398324
MIRT130165	hsa-miR-548t-3p	PAR-CLIP	24398324
MIRT130244	hsa-miR-8083	PAR-CLIP	24398324
MIRT130231	hsa-miR-6826-5p	PAR-CLIP	24398324
MIRT130206	hsa-miR-5196-3p	PAR-CLIP	24398324
MIRT130241	hsa-miR-8060	PAR-CLIP	24398324
MIRT130162	hsa-miR-2116-3p	PAR-CLIP	24398324
MIRT500633	hsa-miR-4666a-5p	PAR-CLIP	24398324
MIRT130194	hsa-miR-4709-3p	PAR-CLIP	24398324
MIRT500632	hsa-miR-455-3p	PAR-CLIP	24398324
MIRT130236	hsa-miR-6516-5p	PAR-CLIP	24398324
MIRT130120	hsa-miR-520b	PAR-CLIP	24398324
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	24398324
MIRT005561	hsa-miR-373-3p	PAR-CLIP	24398324
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	24398324
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	24398324
MIRT054148	hsa-miR-372-3p	PAR-CLIP	24398324
MIRT130113	hsa-miR-520e	PAR-CLIP	24398324
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	24398324
MIRT130159	hsa-miR-302e	PAR-CLIP	24398324
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	24398324
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	24398324
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	24398324
MIRT130067	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT130070	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT130091	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT130105	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT130073	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT130118	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT130124	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT130075	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT130120	hsa-miR-520b	PAR-CLIP	24398324
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	24398324
MIRT005561	hsa-miR-373-3p	PAR-CLIP	24398324
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	24398324
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	24398324
MIRT054148	hsa-miR-372-3p	PAR-CLIP	24398324
MIRT130113	hsa-miR-520e	PAR-CLIP	24398324
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	24398324
MIRT130159	hsa-miR-302e	PAR-CLIP	24398324
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	24398324
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	24398324
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	24398324
MIRT059168	hsa-miR-6768-5p	PAR-CLIP	24398324
MIRT246189	hsa-miR-4700-3p	PAR-CLIP	24398324
MIRT246191	hsa-miR-5586-3p	PAR-CLIP	24398324
MIRT180554	hsa-miR-512-3p	PAR-CLIP	24398324
MIRT130149	hsa-miR-889-5p	PAR-CLIP	24398324
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	24398324
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	24398324
MIRT130126	hsa-miR-520g-3p	PAR-CLIP	24398324
MIRT130128	hsa-miR-520h	PAR-CLIP	24398324
MIRT246185	hsa-miR-4436a	PAR-CLIP	24398324
MIRT246190	hsa-miR-5000-3p	PAR-CLIP	24398324
MIRT180553	hsa-miR-17-3p	PAR-CLIP	24398324
MIRT180560	hsa-miR-6868-5p	PAR-CLIP	24398324
MIRT500631	hsa-miR-642a-3p	PAR-CLIP	24398324
MIRT500630	hsa-miR-642b-3p	PAR-CLIP	24398324
MIRT246187	hsa-miR-4513	PAR-CLIP	24398324
MIRT246200	hsa-miR-6855-3p	PAR-CLIP	24398324
MIRT500629	hsa-miR-6857-3p	PAR-CLIP	24398324
MIRT246188	hsa-miR-4693-3p	PAR-CLIP	24398324
MIRT246181	hsa-miR-3184-5p	PAR-CLIP	24398324
MIRT246175	hsa-miR-423-5p	PAR-CLIP	24398324
MIRT500628	hsa-miR-1914-3p	PAR-CLIP	24398324
MIRT500627	hsa-miR-5194	PAR-CLIP	24398324
MIRT500626	hsa-miR-6738-5p	PAR-CLIP	24398324
MIRT246177	hsa-miR-1236-5p	PAR-CLIP	24398324
MIRT500625	hsa-miR-6499-3p	PAR-CLIP	24398324
MIRT500624	hsa-miR-31-3p	PAR-CLIP	24398324
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	24398324
MIRT180555	hsa-miR-885-3p	PAR-CLIP	24398324
MIRT246196	hsa-miR-6762-5p	PAR-CLIP	24398324
MIRT246198	hsa-miR-6845-5p	PAR-CLIP	24398324
MIRT246172	hsa-miR-134-5p	PAR-CLIP	24398324
MIRT246178	hsa-miR-3118	PAR-CLIP	24398324
MIRT246179	hsa-miR-3136-5p	PAR-CLIP	24398324
MIRT246186	hsa-miR-4439	PAR-CLIP	24398324
MIRT180559	hsa-miR-6734-5p	PAR-CLIP	24398324
MIRT500622	hsa-miR-1202	PAR-CLIP	24398324
MIRT130076	hsa-miR-148a-3p	PAR-CLIP	24398324
MIRT130085	hsa-miR-152-3p	PAR-CLIP	24398324
MIRT019486	hsa-miR-148b-3p	PAR-CLIP	24398324
MIRT500621	hsa-miR-618	PAR-CLIP	24398324
MIRT246199	hsa-miR-6854-5p	PAR-CLIP	24398324
MIRT500620	hsa-miR-4330	PAR-CLIP	24398324
MIRT500619	hsa-miR-3064-5p	PAR-CLIP	24398324
MIRT500618	hsa-miR-6504-5p	PAR-CLIP	24398324
MIRT246182	hsa-miR-3670	PAR-CLIP	24398324
MIRT500617	hsa-miR-3194-3p	PAR-CLIP	24398324
MIRT500616	hsa-miR-1537-5p	PAR-CLIP	24398324
MIRT500615	hsa-miR-4633-3p	PAR-CLIP	24398324
MIRT500614	hsa-miR-6500-5p	PAR-CLIP	24398324
MIRT500613	hsa-miR-7974	PAR-CLIP	24398324
MIRT500612	hsa-miR-4687-3p	PAR-CLIP	24398324
MIRT246174	hsa-miR-363-5p	PAR-CLIP	24398324
MIRT246194	hsa-miR-6745	PAR-CLIP	24398324
MIRT246202	hsa-miR-6880-5p	PAR-CLIP	24398324
MIRT246192	hsa-miR-5691	PAR-CLIP	24398324
MIRT246197	hsa-miR-6805-3p	PAR-CLIP	24398324
MIRT246201	hsa-miR-6874-5p	PAR-CLIP	24398324
MIRT266198	hsa-miR-2054	PAR-CLIP	24398324
MIRT464927	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT464926	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT464924	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT464925	hsa-miR-323a-3p	PAR-CLIP	23592263
MIRT464923	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT464922	hsa-miR-4257	PAR-CLIP	23592263
MIRT464921	hsa-miR-1180-5p	PAR-CLIP	23592263
MIRT464920	hsa-miR-7114-3p	PAR-CLIP	23592263
MIRT266191	hsa-miR-3975	PAR-CLIP	23592263
MIRT464919	hsa-miR-711	PAR-CLIP	23592263
MIRT464918	hsa-miR-8071	PAR-CLIP	23592263
MIRT464917	hsa-miR-4800-5p	PAR-CLIP	23592263
MIRT464916	hsa-miR-155-3p	PAR-CLIP	23592263
MIRT266189	hsa-miR-4476	PAR-CLIP	23592263
MIRT266192	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT464915	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT464914	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT464913	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT464912	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT464911	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT464910	hsa-miR-3158-3p	PAR-CLIP	23592263
MIRT464909	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT464908	hsa-miR-18a-3p	PAR-CLIP	23592263
MIRT180535	hsa-miR-3179	PAR-CLIP	23592263
MIRT130150	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT464907	hsa-miR-4290	PAR-CLIP	23592263
MIRT464906	hsa-miR-3202	PAR-CLIP	23592263
MIRT130164	hsa-miR-3119	PAR-CLIP	23592263
MIRT130221	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT130091	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT130070	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT130091	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT130067	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT130105	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT130073	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT130124	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT130070	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT130082	hsa-miR-135a-5p	Luciferase reporter assay	26885264
MIRT130078	hsa-miR-204-5p	Luciferase reporter assay	27121770
MIRT130079	hsa-miR-211-5p	Luciferase reporter assay	27121770
MIRT005561	hsa-miR-373-3p	Luciferase reporter assay, Western blot	26196741
MIRT022063	hsa-miR-128-3p	PAR-CLIP	27292025
MIRT180544	hsa-miR-194-3p	PAR-CLIP	27292025
MIRT505267	hsa-miR-212-5p	PAR-CLIP	27292025
MIRT059145	hsa-miR-216a-3p	PAR-CLIP	27292025
MIRT059146	hsa-miR-224-5p	PAR-CLIP	27292025
MIRT505265	hsa-miR-2277-3p	PAR-CLIP	27292025
MIRT059144	hsa-miR-27a-3p	PAR-CLIP	27292025
MIRT059147	hsa-miR-27b-3p	PAR-CLIP	27292025
MIRT180535	hsa-miR-3179	PAR-CLIP	27292025
MIRT059152	hsa-miR-3189-3p	PAR-CLIP	27292025
MIRT059148	hsa-miR-335-5p	PAR-CLIP	27292025
MIRT505263	hsa-miR-3616-5p	PAR-CLIP	27292025
MIRT059154	hsa-miR-3681-3p	PAR-CLIP	27292025
MIRT180547	hsa-miR-3929	PAR-CLIP	27292025
MIRT059155	hsa-miR-3940-5p	PAR-CLIP	27292025
MIRT059153	hsa-miR-4326	PAR-CLIP	27292025
MIRT180549	hsa-miR-4419b	PAR-CLIP	27292025
MIRT180548	hsa-miR-4478	PAR-CLIP	27292025
MIRT059156	hsa-miR-4507	PAR-CLIP	27292025
MIRT059157	hsa-miR-4691-5p	PAR-CLIP	27292025
MIRT180551	hsa-miR-4708-3p	PAR-CLIP	27292025
MIRT059158	hsa-miR-5193	PAR-CLIP	27292025
MIRT505262	hsa-miR-573	PAR-CLIP	27292025
MIRT505264	hsa-miR-629-5p	PAR-CLIP	27292025
MIRT059151	hsa-miR-660-3p	PAR-CLIP	27292025
MIRT059159	hsa-miR-6749-3p	PAR-CLIP	27292025
MIRT059161	hsa-miR-6792-3p	PAR-CLIP	27292025
MIRT180552	hsa-miR-6809-5p	PAR-CLIP	27292025
MIRT059162	hsa-miR-6839-3p	PAR-CLIP	27292025
MIRT732543	hsa-miR-223-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33481338
MIRT735029	hsa-miR-141-3p	Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, Flow cytometry	32984347
MIRT059164	hsa-miR-152-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunocytochemistry (ICC)	32056038
MIRT735630	hsa-miR-20b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32013265
MIRT130076	hsa-miR-148a-3p	Microarray, Immunoprecipitaion (IP), qRT-PCR	34075147
MIRT130120	hsa-miR-520b	PAR-CLIP	20371350
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT005561	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT054148	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT130113	hsa-miR-520e	PAR-CLIP	20371350
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT130159	hsa-miR-302e	PAR-CLIP	20371350
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT130067	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT130070	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT130091	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT130105	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT130073	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT130118	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT130124	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT130075	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561377	hsa-miR-3609	PAR-CLIP	20371350
MIRT561378	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561376	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT561375	hsa-miR-4511	PAR-CLIP	20371350
MIRT130192	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT130120	hsa-miR-520b	PAR-CLIP	20371350
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT005561	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT054148	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT130113	hsa-miR-520e	PAR-CLIP	20371350
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT130159	hsa-miR-302e	PAR-CLIP	20371350
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT180554	hsa-miR-512-3p	PAR-CLIP	20371350
MIRT180553	hsa-miR-17-3p	PAR-CLIP	20371350
MIRT180560	hsa-miR-6868-5p	PAR-CLIP	20371350
MIRT246181	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT246175	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT500628	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT500627	hsa-miR-5194	PAR-CLIP	20371350
MIRT500626	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT500625	hsa-miR-6499-3p	PAR-CLIP	20371350
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	20371350
MIRT180555	hsa-miR-885-3p	PAR-CLIP	20371350
MIRT246196	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT246198	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT180559	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT500622	hsa-miR-1202	PAR-CLIP	20371350
MIRT561377	hsa-miR-3609	PAR-CLIP	20371350
MIRT561378	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561376	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT561375	hsa-miR-4511	PAR-CLIP	20371350
MIRT130131	hsa-miR-499a-3p	PAR-CLIP	20371350
MIRT130199	hsa-miR-499b-3p	PAR-CLIP	20371350
MIRT130192	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT571581	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT571580	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT505261	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT059163	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT505260	hsa-miR-4539	PAR-CLIP	20371350
MIRT059166	hsa-miR-3689d	PAR-CLIP	20371350
MIRT059169	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT025554	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT130094	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT130106	hsa-miR-449a	PAR-CLIP	20371350
MIRT130146	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT130215	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT059164	hsa-miR-152-5p	PAR-CLIP	20371350
MIRT059165	hsa-miR-4443	PAR-CLIP	20371350
MIRT059167	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT565132	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT565131	hsa-miR-495-3p	PAR-CLIP	20371350
MIRT565130	hsa-miR-5688	PAR-CLIP	20371350
MIRT266194	hsa-miR-1273d	PAR-CLIP	20371350
MIRT266193	hsa-miR-101-5p	PAR-CLIP	20371350
MIRT565129	hsa-miR-3065-5p	PAR-CLIP	20371350
MIRT565128	hsa-miR-4682	PAR-CLIP	20371350
MIRT332871	hsa-miR-2861	PAR-CLIP	20371350
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT130148	hsa-miR-454-3p	PAR-CLIP	20371350
MIRT130171	hsa-miR-4295	PAR-CLIP	20371350
MIRT130176	hsa-miR-3666	PAR-CLIP	20371350
MIRT130095	hsa-miR-301a-3p	PAR-CLIP	20371350
MIRT130097	hsa-miR-130b-3p	PAR-CLIP	20371350
MIRT130152	hsa-miR-301b-3p	PAR-CLIP	20371350
MIRT130081	hsa-miR-130a-3p	PAR-CLIP	20371350
MIRT130181	hsa-miR-548aa	PAR-CLIP	20371350
MIRT130205	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT130165	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT130231	hsa-miR-6826-5p	PAR-CLIP	20371350
MIRT130206	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT130241	hsa-miR-8060	PAR-CLIP	20371350
MIRT130123	hsa-miR-519d-5p	PAR-CLIP	20371350
MIRT130162	hsa-miR-2116-3p	PAR-CLIP	20371350
MIRT130164	hsa-miR-3119	PAR-CLIP	20371350
MIRT500633	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT130194	hsa-miR-4709-3p	PAR-CLIP	20371350
MIRT500632	hsa-miR-455-3p	PAR-CLIP	20371350
MIRT130236	hsa-miR-6516-5p	PAR-CLIP	20371350
MIRT505261	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT059163	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT505260	hsa-miR-4539	PAR-CLIP	20371350
MIRT059166	hsa-miR-3689d	PAR-CLIP	20371350
MIRT059169	hsa-miR-6851-5p	PAR-CLIP	20371350
MIRT025554	hsa-miR-34a-5p	PAR-CLIP	20371350
MIRT130094	hsa-miR-34c-5p	PAR-CLIP	20371350
MIRT130106	hsa-miR-449a	PAR-CLIP	20371350
MIRT130146	hsa-miR-449b-5p	PAR-CLIP	20371350
MIRT130215	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT059164	hsa-miR-152-5p	PAR-CLIP	20371350
MIRT059165	hsa-miR-4443	PAR-CLIP	20371350
MIRT059167	hsa-miR-6515-5p	PAR-CLIP	20371350
MIRT130120	hsa-miR-520b	PAR-CLIP	20371350
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT005561	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT054148	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT130113	hsa-miR-520e	PAR-CLIP	20371350
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT130159	hsa-miR-302e	PAR-CLIP	20371350
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT130067	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT130070	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT130091	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT130105	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT130073	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT130118	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT130124	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT130075	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT561377	hsa-miR-3609	PAR-CLIP	20371350
MIRT561378	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT561376	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	20371350
MIRT561375	hsa-miR-4511	PAR-CLIP	20371350
MIRT130131	hsa-miR-499a-3p	PAR-CLIP	20371350
MIRT130199	hsa-miR-499b-3p	PAR-CLIP	20371350
MIRT130192	hsa-miR-4639-5p	PAR-CLIP	20371350
MIRT130120	hsa-miR-520b	PAR-CLIP	21572407
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	21572407
MIRT005561	hsa-miR-373-3p	PAR-CLIP	21572407
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	21572407
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	21572407
MIRT054148	hsa-miR-372-3p	PAR-CLIP	21572407
MIRT130113	hsa-miR-520e	PAR-CLIP	21572407
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	21572407
MIRT130159	hsa-miR-302e	PAR-CLIP	21572407
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	21572407
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	21572407
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	21572407
MIRT246191	hsa-miR-5586-3p	PAR-CLIP	21572407
MIRT180554	hsa-miR-512-3p	PAR-CLIP	21572407
MIRT130149	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT246195	hsa-miR-6761-5p	PAR-CLIP	21572407
MIRT246187	hsa-miR-4513	PAR-CLIP	21572407
MIRT246200	hsa-miR-6855-3p	PAR-CLIP	21572407
MIRT500629	hsa-miR-6857-3p	PAR-CLIP	21572407
MIRT246188	hsa-miR-4693-3p	PAR-CLIP	21572407
MIRT246177	hsa-miR-1236-5p	PAR-CLIP	21572407
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	21572407
MIRT246172	hsa-miR-134-5p	PAR-CLIP	21572407
MIRT246178	hsa-miR-3118	PAR-CLIP	21572407
MIRT246179	hsa-miR-3136-5p	PAR-CLIP	21572407
MIRT246186	hsa-miR-4439	PAR-CLIP	21572407
MIRT130135	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT130137	hsa-miR-548b-3p	PAR-CLIP	22012620
MIRT130089	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT130232	hsa-miR-6832-3p	PAR-CLIP	22012620
MIRT130143	hsa-miR-623	PAR-CLIP	22012620
MIRT130078	hsa-miR-204-5p	PAR-CLIP	22012620
MIRT130079	hsa-miR-211-5p	PAR-CLIP	22012620
MIRT533399	hsa-miR-548s	PAR-CLIP	22012620
MIRT130193	hsa-miR-4701-5p	PAR-CLIP	22012620
MIRT130138	hsa-miR-588	PAR-CLIP	22012620
MIRT533398	hsa-miR-4435	PAR-CLIP	22012620
MIRT533397	hsa-miR-3187-3p	PAR-CLIP	22012620
MIRT130197	hsa-miR-4755-5p	PAR-CLIP	22012620
MIRT130203	hsa-miR-5006-3p	PAR-CLIP	22012620
MIRT130186	hsa-miR-4446-5p	PAR-CLIP	22012620
MIRT332889	hsa-miR-3126-3p	PAR-CLIP	22012620
MIRT332886	hsa-miR-1298-3p	PAR-CLIP	22012620
MIRT533396	hsa-miR-29b-1-5p	PAR-CLIP	22012620
MIRT130120	hsa-miR-520b	PAR-CLIP	23446348
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	23446348
MIRT005561	hsa-miR-373-3p	PAR-CLIP	23446348
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	23446348
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	23446348
MIRT054148	hsa-miR-372-3p	PAR-CLIP	23446348
MIRT130113	hsa-miR-520e	PAR-CLIP	23446348
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	23446348
MIRT130159	hsa-miR-302e	PAR-CLIP	23446348
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	23446348
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	23446348
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	23446348
MIRT180554	hsa-miR-512-3p	PAR-CLIP	23446348
MIRT180553	hsa-miR-17-3p	PAR-CLIP	23446348
MIRT180560	hsa-miR-6868-5p	PAR-CLIP	23446348
MIRT246181	hsa-miR-3184-5p	PAR-CLIP	23446348
MIRT246175	hsa-miR-423-5p	PAR-CLIP	23446348
MIRT500628	hsa-miR-1914-3p	PAR-CLIP	23446348
MIRT500627	hsa-miR-5194	PAR-CLIP	23446348
MIRT500626	hsa-miR-6738-5p	PAR-CLIP	23446348
MIRT500625	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	23446348
MIRT180555	hsa-miR-885-3p	PAR-CLIP	23446348
MIRT246196	hsa-miR-6762-5p	PAR-CLIP	23446348
MIRT246198	hsa-miR-6845-5p	PAR-CLIP	23446348
MIRT180559	hsa-miR-6734-5p	PAR-CLIP	23446348
MIRT500622	hsa-miR-1202	PAR-CLIP	23446348
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	23446348
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	23446348
MIRT130148	hsa-miR-454-3p	PAR-CLIP	23446348
MIRT130171	hsa-miR-4295	PAR-CLIP	23446348
MIRT130176	hsa-miR-3666	PAR-CLIP	23446348
MIRT130095	hsa-miR-301a-3p	PAR-CLIP	23446348
MIRT130097	hsa-miR-130b-3p	PAR-CLIP	23446348
MIRT130152	hsa-miR-301b-3p	PAR-CLIP	23446348
MIRT130081	hsa-miR-130a-3p	PAR-CLIP	23446348
MIRT130076	hsa-miR-148a-3p	PAR-CLIP	23446348
MIRT130085	hsa-miR-152-3p	PAR-CLIP	23446348
MIRT019486	hsa-miR-148b-3p	PAR-CLIP	23446348
MIRT130181	hsa-miR-548aa	PAR-CLIP	23446348
MIRT130205	hsa-miR-548ap-3p	PAR-CLIP	23446348
MIRT130165	hsa-miR-548t-3p	PAR-CLIP	23446348
MIRT332866	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT130231	hsa-miR-6826-5p	PAR-CLIP	23446348
MIRT130206	hsa-miR-5196-3p	PAR-CLIP	23446348
MIRT130123	hsa-miR-519d-5p	PAR-CLIP	23446348
MIRT130162	hsa-miR-2116-3p	PAR-CLIP	23446348
MIRT500632	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT130236	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT022063	hsa-miR-128-3p	PAR-CLIP	23446348
MIRT059145	hsa-miR-216a-3p	PAR-CLIP	23446348
MIRT059154	hsa-miR-3681-3p	PAR-CLIP	23446348
MIRT059146	hsa-miR-224-5p	PAR-CLIP	23446348
MIRT180547	hsa-miR-3929	PAR-CLIP	23446348
MIRT180549	hsa-miR-4419b	PAR-CLIP	23446348
MIRT180548	hsa-miR-4478	PAR-CLIP	23446348
MIRT059148	hsa-miR-335-5p	PAR-CLIP	23446348
MIRT180544	hsa-miR-194-3p	PAR-CLIP	23446348
MIRT059158	hsa-miR-5193	PAR-CLIP	23446348
MIRT059151	hsa-miR-660-3p	PAR-CLIP	23446348
MIRT505267	hsa-miR-212-5p	PAR-CLIP	23446348
MIRT059152	hsa-miR-3189-3p	PAR-CLIP	23446348
MIRT505266	hsa-miR-4304	PAR-CLIP	23446348
MIRT505265	hsa-miR-2277-3p	PAR-CLIP	23446348
MIRT180551	hsa-miR-4708-3p	PAR-CLIP	23446348
MIRT180552	hsa-miR-6809-5p	PAR-CLIP	23446348
MIRT505264	hsa-miR-629-5p	PAR-CLIP	23446348
MIRT059153	hsa-miR-4326	PAR-CLIP	23446348
MIRT059144	hsa-miR-27a-3p	PAR-CLIP	23446348
MIRT059147	hsa-miR-27b-3p	PAR-CLIP	23446348
MIRT059157	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT059161	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT059159	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT505263	hsa-miR-3616-5p	PAR-CLIP	23446348
MIRT505262	hsa-miR-573	PAR-CLIP	23446348
MIRT059155	hsa-miR-3940-5p	PAR-CLIP	23446348
MIRT059156	hsa-miR-4507	PAR-CLIP	23446348
MIRT059162	hsa-miR-6839-3p	PAR-CLIP	23446348
MIRT505261	hsa-miR-5002-5p	PAR-CLIP	23446348
MIRT059163	hsa-miR-16-1-3p	PAR-CLIP	23446348
MIRT505260	hsa-miR-4539	PAR-CLIP	23446348
MIRT059166	hsa-miR-3689d	PAR-CLIP	23446348
MIRT059169	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT025554	hsa-miR-34a-5p	PAR-CLIP	23446348
MIRT130094	hsa-miR-34c-5p	PAR-CLIP	23446348
MIRT130106	hsa-miR-449a	PAR-CLIP	23446348
MIRT130146	hsa-miR-449b-5p	PAR-CLIP	23446348
MIRT130215	hsa-miR-548au-3p	PAR-CLIP	23446348
MIRT059164	hsa-miR-152-5p	PAR-CLIP	23446348
MIRT059165	hsa-miR-4443	PAR-CLIP	23446348
MIRT059167	hsa-miR-6515-5p	PAR-CLIP	23446348
MIRT464927	hsa-miR-18a-5p	PAR-CLIP	24398324
MIRT464926	hsa-miR-18b-5p	PAR-CLIP	24398324
MIRT464924	hsa-miR-4735-3p	PAR-CLIP	24398324
MIRT464925	hsa-miR-323a-3p	PAR-CLIP	24398324
MIRT266189	hsa-miR-4476	PAR-CLIP	24398324
MIRT266192	hsa-miR-6876-5p	PAR-CLIP	24398324
MIRT464923	hsa-miR-6847-5p	PAR-CLIP	24398324
MIRT464922	hsa-miR-4257	PAR-CLIP	24398324
MIRT464921	hsa-miR-1180-5p	PAR-CLIP	24398324
MIRT464920	hsa-miR-7114-3p	PAR-CLIP	24398324
MIRT266191	hsa-miR-3975	PAR-CLIP	24398324
MIRT464919	hsa-miR-711	PAR-CLIP	24398324
MIRT464918	hsa-miR-8071	PAR-CLIP	24398324
MIRT464917	hsa-miR-4800-5p	PAR-CLIP	24398324
MIRT464916	hsa-miR-155-3p	PAR-CLIP	24398324
MIRT130148	hsa-miR-454-3p	PAR-CLIP	24398324
MIRT130171	hsa-miR-4295	PAR-CLIP	24398324
MIRT130176	hsa-miR-3666	PAR-CLIP	24398324
MIRT130095	hsa-miR-301a-3p	PAR-CLIP	24398324
MIRT130097	hsa-miR-130b-3p	PAR-CLIP	24398324
MIRT130152	hsa-miR-301b-3p	PAR-CLIP	24398324
MIRT130081	hsa-miR-130a-3p	PAR-CLIP	24398324
MIRT130181	hsa-miR-548aa	PAR-CLIP	24398324
MIRT130205	hsa-miR-548ap-3p	PAR-CLIP	24398324
MIRT130165	hsa-miR-548t-3p	PAR-CLIP	24398324
MIRT130244	hsa-miR-8083	PAR-CLIP	24398324
MIRT130231	hsa-miR-6826-5p	PAR-CLIP	24398324
MIRT130206	hsa-miR-5196-3p	PAR-CLIP	24398324
MIRT130241	hsa-miR-8060	PAR-CLIP	24398324
MIRT130162	hsa-miR-2116-3p	PAR-CLIP	24398324
MIRT500633	hsa-miR-4666a-5p	PAR-CLIP	24398324
MIRT130194	hsa-miR-4709-3p	PAR-CLIP	24398324
MIRT500632	hsa-miR-455-3p	PAR-CLIP	24398324
MIRT130236	hsa-miR-6516-5p	PAR-CLIP	24398324
MIRT130120	hsa-miR-520b	PAR-CLIP	24398324
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	24398324
MIRT005561	hsa-miR-373-3p	PAR-CLIP	24398324
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	24398324
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	24398324
MIRT054148	hsa-miR-372-3p	PAR-CLIP	24398324
MIRT130113	hsa-miR-520e	PAR-CLIP	24398324
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	24398324
MIRT130159	hsa-miR-302e	PAR-CLIP	24398324
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	24398324
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	24398324
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	24398324
MIRT130067	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT130070	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT130091	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT130105	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT130073	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT130118	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT130124	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT130075	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT130120	hsa-miR-520b	PAR-CLIP	24398324
MIRT130098	hsa-miR-302b-3p	PAR-CLIP	24398324
MIRT005561	hsa-miR-373-3p	PAR-CLIP	24398324
MIRT130121	hsa-miR-520c-3p	PAR-CLIP	24398324
MIRT130125	hsa-miR-520d-3p	PAR-CLIP	24398324
MIRT054148	hsa-miR-372-3p	PAR-CLIP	24398324
MIRT130113	hsa-miR-520e	PAR-CLIP	24398324
MIRT130117	hsa-miR-520a-3p	PAR-CLIP	24398324
MIRT130159	hsa-miR-302e	PAR-CLIP	24398324
MIRT130093	hsa-miR-302a-3p	PAR-CLIP	24398324
MIRT130099	hsa-miR-302c-3p	PAR-CLIP	24398324
MIRT130100	hsa-miR-302d-3p	PAR-CLIP	24398324
MIRT059168	hsa-miR-6768-5p	PAR-CLIP	24398324
MIRT246189	hsa-miR-4700-3p	PAR-CLIP	24398324
MIRT246191	hsa-miR-5586-3p	PAR-CLIP	24398324
MIRT180554	hsa-miR-512-3p	PAR-CLIP	24398324
MIRT130149	hsa-miR-889-5p	PAR-CLIP	24398324
MIRT130082	hsa-miR-135a-5p	PAR-CLIP	24398324
MIRT130101	hsa-miR-135b-5p	PAR-CLIP	24398324
MIRT130126	hsa-miR-520g-3p	PAR-CLIP	24398324
MIRT130128	hsa-miR-520h	PAR-CLIP	24398324
MIRT246185	hsa-miR-4436a	PAR-CLIP	24398324
MIRT246190	hsa-miR-5000-3p	PAR-CLIP	24398324
MIRT180553	hsa-miR-17-3p	PAR-CLIP	24398324
MIRT180560	hsa-miR-6868-5p	PAR-CLIP	24398324
MIRT500631	hsa-miR-642a-3p	PAR-CLIP	24398324
MIRT500630	hsa-miR-642b-3p	PAR-CLIP	24398324
MIRT246187	hsa-miR-4513	PAR-CLIP	24398324
MIRT246200	hsa-miR-6855-3p	PAR-CLIP	24398324
MIRT500629	hsa-miR-6857-3p	PAR-CLIP	24398324
MIRT246188	hsa-miR-4693-3p	PAR-CLIP	24398324
MIRT246181	hsa-miR-3184-5p	PAR-CLIP	24398324
MIRT246175	hsa-miR-423-5p	PAR-CLIP	24398324
MIRT500628	hsa-miR-1914-3p	PAR-CLIP	24398324
MIRT500627	hsa-miR-5194	PAR-CLIP	24398324
MIRT500626	hsa-miR-6738-5p	PAR-CLIP	24398324
MIRT246177	hsa-miR-1236-5p	PAR-CLIP	24398324
MIRT500625	hsa-miR-6499-3p	PAR-CLIP	24398324
MIRT500624	hsa-miR-31-3p	PAR-CLIP	24398324
MIRT500623	hsa-miR-5580-5p	PAR-CLIP	24398324
MIRT180555	hsa-miR-885-3p	PAR-CLIP	24398324
MIRT246196	hsa-miR-6762-5p	PAR-CLIP	24398324
MIRT246198	hsa-miR-6845-5p	PAR-CLIP	24398324
MIRT246172	hsa-miR-134-5p	PAR-CLIP	24398324
MIRT246178	hsa-miR-3118	PAR-CLIP	24398324
MIRT246179	hsa-miR-3136-5p	PAR-CLIP	24398324
MIRT246186	hsa-miR-4439	PAR-CLIP	24398324
MIRT180559	hsa-miR-6734-5p	PAR-CLIP	24398324
MIRT500622	hsa-miR-1202	PAR-CLIP	24398324
MIRT130076	hsa-miR-148a-3p	PAR-CLIP	24398324
MIRT130085	hsa-miR-152-3p	PAR-CLIP	24398324
MIRT019486	hsa-miR-148b-3p	PAR-CLIP	24398324
MIRT500621	hsa-miR-618	PAR-CLIP	24398324
MIRT246199	hsa-miR-6854-5p	PAR-CLIP	24398324
MIRT500620	hsa-miR-4330	PAR-CLIP	24398324
MIRT500619	hsa-miR-3064-5p	PAR-CLIP	24398324
MIRT500618	hsa-miR-6504-5p	PAR-CLIP	24398324
MIRT246182	hsa-miR-3670	PAR-CLIP	24398324
MIRT500617	hsa-miR-3194-3p	PAR-CLIP	24398324
MIRT500616	hsa-miR-1537-5p	PAR-CLIP	24398324
MIRT500615	hsa-miR-4633-3p	PAR-CLIP	24398324
MIRT500614	hsa-miR-6500-5p	PAR-CLIP	24398324
MIRT500613	hsa-miR-7974	PAR-CLIP	24398324
MIRT500612	hsa-miR-4687-3p	PAR-CLIP	24398324
MIRT246174	hsa-miR-363-5p	PAR-CLIP	24398324
MIRT246194	hsa-miR-6745	PAR-CLIP	24398324
MIRT246202	hsa-miR-6880-5p	PAR-CLIP	24398324
MIRT246192	hsa-miR-5691	PAR-CLIP	24398324
MIRT246197	hsa-miR-6805-3p	PAR-CLIP	24398324
MIRT246201	hsa-miR-6874-5p	PAR-CLIP	24398324
MIRT266198	hsa-miR-2054	PAR-CLIP	24398324
MIRT464927	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT464926	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT464924	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT464925	hsa-miR-323a-3p	PAR-CLIP	23592263
MIRT464923	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT464922	hsa-miR-4257	PAR-CLIP	23592263
MIRT464921	hsa-miR-1180-5p	PAR-CLIP	23592263
MIRT464920	hsa-miR-7114-3p	PAR-CLIP	23592263
MIRT266191	hsa-miR-3975	PAR-CLIP	23592263
MIRT464919	hsa-miR-711	PAR-CLIP	23592263
MIRT464918	hsa-miR-8071	PAR-CLIP	23592263
MIRT464917	hsa-miR-4800-5p	PAR-CLIP	23592263
MIRT464916	hsa-miR-155-3p	PAR-CLIP	23592263
MIRT266189	hsa-miR-4476	PAR-CLIP	23592263
MIRT266192	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT464915	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT464914	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT464913	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT464912	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT464911	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT464910	hsa-miR-3158-3p	PAR-CLIP	23592263
MIRT464909	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT464908	hsa-miR-18a-3p	PAR-CLIP	23592263
MIRT180535	hsa-miR-3179	PAR-CLIP	23592263
MIRT130150	hsa-miR-873-5p	PAR-CLIP	23592263
MIRT464907	hsa-miR-4290	PAR-CLIP	23592263
MIRT464906	hsa-miR-3202	PAR-CLIP	23592263
MIRT130164	hsa-miR-3119	PAR-CLIP	23592263
MIRT130221	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT755661	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence, In situ hybridization	38180639
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT1465246	hsa-miR-1185	CLIP-seq
MIRT1465247	hsa-miR-1255a	CLIP-seq
MIRT1465248	hsa-miR-1255b	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT1465250	hsa-miR-1283	CLIP-seq
MIRT1465251	hsa-miR-129-5p	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1465257	hsa-miR-141	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465260	hsa-miR-149	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465266	hsa-miR-186	CLIP-seq
MIRT1465267	hsa-miR-188-5p	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465269	hsa-miR-198	CLIP-seq
MIRT1465270	hsa-miR-200a	CLIP-seq
MIRT1465271	hsa-miR-208a	CLIP-seq
MIRT1465272	hsa-miR-208b	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT1465275	hsa-miR-216a	CLIP-seq
MIRT1465276	hsa-miR-224	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1465279	hsa-miR-27a	CLIP-seq
MIRT1465280	hsa-miR-27b	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465287	hsa-miR-3151	CLIP-seq
MIRT1465288	hsa-miR-3153	CLIP-seq
MIRT1465289	hsa-miR-3157-5p	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT1465291	hsa-miR-335	CLIP-seq
MIRT1465292	hsa-miR-337-3p	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465294	hsa-miR-34b	CLIP-seq
MIRT1465295	hsa-miR-3605-5p	CLIP-seq
MIRT1465296	hsa-miR-3613-3p	CLIP-seq
MIRT1465297	hsa-miR-3647-3p	CLIP-seq
MIRT1465298	hsa-miR-3647-5p	CLIP-seq
MIRT1465299	hsa-miR-3653	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1465301	hsa-miR-3660	CLIP-seq
MIRT1465302	hsa-miR-3667-5p	CLIP-seq
MIRT1465303	hsa-miR-3679-5p	CLIP-seq
MIRT1465304	hsa-miR-3686	CLIP-seq
MIRT1465305	hsa-miR-369-3p	CLIP-seq
MIRT1465306	hsa-miR-371-5p	CLIP-seq
MIRT1465307	hsa-miR-371b-5p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT1465310	hsa-miR-374a	CLIP-seq
MIRT1465311	hsa-miR-374b	CLIP-seq
MIRT1465312	hsa-miR-374c	CLIP-seq
MIRT1465313	hsa-miR-410	CLIP-seq
MIRT1465314	hsa-miR-411	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT1465316	hsa-miR-4260	CLIP-seq
MIRT1465317	hsa-miR-4261	CLIP-seq
MIRT1465318	hsa-miR-4282	CLIP-seq
MIRT1465319	hsa-miR-4477b	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465322	hsa-miR-4526	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1465324	hsa-miR-4666-5p	CLIP-seq
MIRT1465325	hsa-miR-4690-3p	CLIP-seq
MIRT1465326	hsa-miR-4753-5p	CLIP-seq
MIRT1465327	hsa-miR-4761-5p	CLIP-seq
MIRT1465328	hsa-miR-4762-5p	CLIP-seq
MIRT1465329	hsa-miR-4768-3p	CLIP-seq
MIRT1465330	hsa-miR-4778-5p	CLIP-seq
MIRT1465331	hsa-miR-4794	CLIP-seq
MIRT1465332	hsa-miR-4804-3p	CLIP-seq
MIRT1465333	hsa-miR-486-3p	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT1465335	hsa-miR-499-3p	CLIP-seq
MIRT1465336	hsa-miR-499-5p	CLIP-seq
MIRT1465337	hsa-miR-501-5p	CLIP-seq
MIRT1465338	hsa-miR-511	CLIP-seq
MIRT1465339	hsa-miR-513a-5p	CLIP-seq
MIRT1465340	hsa-miR-514	CLIP-seq
MIRT1465341	hsa-miR-519a	CLIP-seq
MIRT1465342	hsa-miR-519b-3p	CLIP-seq
MIRT1465343	hsa-miR-519c-3p	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465345	hsa-miR-520d-5p	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT1465347	hsa-miR-524-5p	CLIP-seq
MIRT1465348	hsa-miR-541	CLIP-seq
MIRT1465349	hsa-miR-548a-5p	CLIP-seq
MIRT1465350	hsa-miR-548ab	CLIP-seq
MIRT1465351	hsa-miR-548ah	CLIP-seq
MIRT1465352	hsa-miR-548ak	CLIP-seq
MIRT1465353	hsa-miR-548b-5p	CLIP-seq
MIRT1465354	hsa-miR-548c-5p	CLIP-seq
MIRT1465355	hsa-miR-548d-5p	CLIP-seq
MIRT1465356	hsa-miR-548h	CLIP-seq
MIRT1465357	hsa-miR-548i	CLIP-seq
MIRT1465358	hsa-miR-548j	CLIP-seq
MIRT1465359	hsa-miR-548k	CLIP-seq
MIRT1465360	hsa-miR-548l	CLIP-seq
MIRT1465361	hsa-miR-548n	CLIP-seq
MIRT1465362	hsa-miR-548w	CLIP-seq
MIRT1465363	hsa-miR-548y	CLIP-seq
MIRT1465364	hsa-miR-559	CLIP-seq
MIRT1465365	hsa-miR-561	CLIP-seq
MIRT1465366	hsa-miR-629	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1465368	hsa-miR-654-5p	CLIP-seq
MIRT1465369	hsa-miR-655	CLIP-seq
MIRT1465370	hsa-miR-665	CLIP-seq
MIRT1465371	hsa-miR-9	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465373	hsa-miR-935	CLIP-seq
MIRT1465374	hsa-miR-936	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465260	hsa-miR-149	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465269	hsa-miR-198	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465289	hsa-miR-3157-5p	CLIP-seq
MIRT1555281	hsa-miR-3174	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465296	hsa-miR-3613-3p	CLIP-seq
MIRT1465297	hsa-miR-3647-3p	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1555282	hsa-miR-3659	CLIP-seq
MIRT1465301	hsa-miR-3660	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT1555284	hsa-miR-3921	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT1465318	hsa-miR-4282	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465322	hsa-miR-4526	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1555285	hsa-miR-4653-5p	CLIP-seq
MIRT1555286	hsa-miR-4658	CLIP-seq
MIRT1465325	hsa-miR-4690-3p	CLIP-seq
MIRT1555287	hsa-miR-4766-5p	CLIP-seq
MIRT1465331	hsa-miR-4794	CLIP-seq
MIRT1465332	hsa-miR-4804-3p	CLIP-seq
MIRT1555288	hsa-miR-495	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT1465351	hsa-miR-548ah	CLIP-seq
MIRT1555289	hsa-miR-548t	CLIP-seq
MIRT1555290	hsa-miR-574-5p	CLIP-seq
MIRT1555291	hsa-miR-593	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT1465370	hsa-miR-665	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT2139937	hsa-miR-1305	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465267	hsa-miR-188-5p	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT2139938	hsa-miR-204	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT2139939	hsa-miR-211	CLIP-seq
MIRT1465275	hsa-miR-216a	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT2139940	hsa-miR-3200-5p	CLIP-seq
MIRT1465291	hsa-miR-335	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1465301	hsa-miR-3660	CLIP-seq
MIRT1465304	hsa-miR-3686	CLIP-seq
MIRT1465306	hsa-miR-371-5p	CLIP-seq
MIRT1465307	hsa-miR-371b-5p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT2139941	hsa-miR-384	CLIP-seq
MIRT1465313	hsa-miR-410	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT2139942	hsa-miR-4251	CLIP-seq
MIRT1465316	hsa-miR-4260	CLIP-seq
MIRT1465318	hsa-miR-4282	CLIP-seq
MIRT2139943	hsa-miR-4329	CLIP-seq
MIRT2139944	hsa-miR-4428	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465322	hsa-miR-4526	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1465324	hsa-miR-4666-5p	CLIP-seq
MIRT2139945	hsa-miR-4683	CLIP-seq
MIRT1465330	hsa-miR-4778-5p	CLIP-seq
MIRT1465333	hsa-miR-486-3p	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT2139946	hsa-miR-498	CLIP-seq
MIRT1465335	hsa-miR-499-3p	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT1465351	hsa-miR-548ah	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT2360562	hsa-miR-1193	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT1465250	hsa-miR-1283	CLIP-seq
MIRT1465251	hsa-miR-129-5p	CLIP-seq
MIRT2139937	hsa-miR-1305	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465257	hsa-miR-141	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465260	hsa-miR-149	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465267	hsa-miR-188-5p	CLIP-seq
MIRT2360563	hsa-miR-18a	CLIP-seq
MIRT2360564	hsa-miR-18b	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465269	hsa-miR-198	CLIP-seq
MIRT1465270	hsa-miR-200a	CLIP-seq
MIRT2139938	hsa-miR-204	CLIP-seq
MIRT2360565	hsa-miR-2053	CLIP-seq
MIRT1465271	hsa-miR-208a	CLIP-seq
MIRT1465272	hsa-miR-208b	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT2139939	hsa-miR-211	CLIP-seq
MIRT1465275	hsa-miR-216a	CLIP-seq
MIRT1465276	hsa-miR-224	CLIP-seq
MIRT2360566	hsa-miR-2278	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465279	hsa-miR-27a	CLIP-seq
MIRT1465280	hsa-miR-27b	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465287	hsa-miR-3151	CLIP-seq
MIRT1465288	hsa-miR-3153	CLIP-seq
MIRT1465289	hsa-miR-3157-5p	CLIP-seq
MIRT1555281	hsa-miR-3174	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT2139940	hsa-miR-3200-5p	CLIP-seq
MIRT2360567	hsa-miR-323-3p	CLIP-seq
MIRT1465291	hsa-miR-335	CLIP-seq
MIRT1465292	hsa-miR-337-3p	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465294	hsa-miR-34b	CLIP-seq
MIRT1465296	hsa-miR-3613-3p	CLIP-seq
MIRT1465297	hsa-miR-3647-3p	CLIP-seq
MIRT1465298	hsa-miR-3647-5p	CLIP-seq
MIRT1465299	hsa-miR-3653	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1555282	hsa-miR-3659	CLIP-seq
MIRT1465301	hsa-miR-3660	CLIP-seq
MIRT1465302	hsa-miR-3667-5p	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465304	hsa-miR-3686	CLIP-seq
MIRT1465305	hsa-miR-369-3p	CLIP-seq
MIRT2360568	hsa-miR-370	CLIP-seq
MIRT1465306	hsa-miR-371-5p	CLIP-seq
MIRT1465307	hsa-miR-371b-5p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT1465310	hsa-miR-374a	CLIP-seq
MIRT1465311	hsa-miR-374b	CLIP-seq
MIRT1465312	hsa-miR-374c	CLIP-seq
MIRT2139941	hsa-miR-384	CLIP-seq
MIRT1555284	hsa-miR-3921	CLIP-seq
MIRT1465313	hsa-miR-410	CLIP-seq
MIRT1465314	hsa-miR-411	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT2139942	hsa-miR-4251	CLIP-seq
MIRT1465316	hsa-miR-4260	CLIP-seq
MIRT1465317	hsa-miR-4261	CLIP-seq
MIRT1465318	hsa-miR-4282	CLIP-seq
MIRT2139943	hsa-miR-4329	CLIP-seq
MIRT2139944	hsa-miR-4428	CLIP-seq
MIRT2360569	hsa-miR-4459	CLIP-seq
MIRT1465319	hsa-miR-4477b	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465322	hsa-miR-4526	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1555285	hsa-miR-4653-5p	CLIP-seq
MIRT1555286	hsa-miR-4658	CLIP-seq
MIRT1465324	hsa-miR-4666-5p	CLIP-seq
MIRT2139945	hsa-miR-4683	CLIP-seq
MIRT1465325	hsa-miR-4690-3p	CLIP-seq
MIRT2360570	hsa-miR-4694-3p	CLIP-seq
MIRT2360571	hsa-miR-4695-5p	CLIP-seq
MIRT2360572	hsa-miR-4732-5p	CLIP-seq
MIRT1465326	hsa-miR-4753-5p	CLIP-seq
MIRT1465328	hsa-miR-4762-5p	CLIP-seq
MIRT2360573	hsa-miR-4763-5p	CLIP-seq
MIRT1555287	hsa-miR-4766-5p	CLIP-seq
MIRT1465329	hsa-miR-4768-3p	CLIP-seq
MIRT1465330	hsa-miR-4778-5p	CLIP-seq
MIRT1465331	hsa-miR-4794	CLIP-seq
MIRT1465332	hsa-miR-4804-3p	CLIP-seq
MIRT1465333	hsa-miR-486-3p	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT2139946	hsa-miR-498	CLIP-seq
MIRT1465335	hsa-miR-499-3p	CLIP-seq
MIRT1465336	hsa-miR-499-5p	CLIP-seq
MIRT1465337	hsa-miR-501-5p	CLIP-seq
MIRT1465338	hsa-miR-511	CLIP-seq
MIRT1465339	hsa-miR-513a-5p	CLIP-seq
MIRT1465340	hsa-miR-514	CLIP-seq
MIRT2360574	hsa-miR-515-5p	CLIP-seq
MIRT2360575	hsa-miR-516a-3p	CLIP-seq
MIRT1465341	hsa-miR-519a	CLIP-seq
MIRT1465342	hsa-miR-519b-3p	CLIP-seq
MIRT1465343	hsa-miR-519c-3p	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465345	hsa-miR-520d-5p	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT1465347	hsa-miR-524-5p	CLIP-seq
MIRT2360576	hsa-miR-539	CLIP-seq
MIRT1465348	hsa-miR-541	CLIP-seq
MIRT1465349	hsa-miR-548a-5p	CLIP-seq
MIRT1465350	hsa-miR-548ab	CLIP-seq
MIRT2360577	hsa-miR-548ac	CLIP-seq
MIRT1465351	hsa-miR-548ah	CLIP-seq
MIRT1465352	hsa-miR-548ak	CLIP-seq
MIRT1465353	hsa-miR-548b-5p	CLIP-seq
MIRT2360578	hsa-miR-548c-3p	CLIP-seq
MIRT1465354	hsa-miR-548c-5p	CLIP-seq
MIRT2360579	hsa-miR-548d-3p	CLIP-seq
MIRT1465355	hsa-miR-548d-5p	CLIP-seq
MIRT1465356	hsa-miR-548h	CLIP-seq
MIRT1465357	hsa-miR-548i	CLIP-seq
MIRT1465358	hsa-miR-548j	CLIP-seq
MIRT1465359	hsa-miR-548k	CLIP-seq
MIRT1465360	hsa-miR-548l	CLIP-seq
MIRT1465361	hsa-miR-548n	CLIP-seq
MIRT1555289	hsa-miR-548t	CLIP-seq
MIRT1465362	hsa-miR-548w	CLIP-seq
MIRT1465363	hsa-miR-548y	CLIP-seq
MIRT2360580	hsa-miR-548z	CLIP-seq
MIRT1465364	hsa-miR-559	CLIP-seq
MIRT1465365	hsa-miR-561	CLIP-seq
MIRT1555290	hsa-miR-574-5p	CLIP-seq
MIRT1555291	hsa-miR-593	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT2360581	hsa-miR-628-5p	CLIP-seq
MIRT1465366	hsa-miR-629	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT2360582	hsa-miR-646	CLIP-seq
MIRT1465368	hsa-miR-654-5p	CLIP-seq
MIRT1465369	hsa-miR-655	CLIP-seq
MIRT1465370	hsa-miR-665	CLIP-seq
MIRT2360583	hsa-miR-760	CLIP-seq
MIRT1465371	hsa-miR-9	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465373	hsa-miR-935	CLIP-seq
MIRT1465374	hsa-miR-936	CLIP-seq
MIRT2360584	hsa-miR-942	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465267	hsa-miR-188-5p	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465271	hsa-miR-208a	CLIP-seq
MIRT1465272	hsa-miR-208b	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT1465276	hsa-miR-224	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465279	hsa-miR-27a	CLIP-seq
MIRT1465280	hsa-miR-27b	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465287	hsa-miR-3151	CLIP-seq
MIRT1465288	hsa-miR-3153	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465294	hsa-miR-34b	CLIP-seq
MIRT1465298	hsa-miR-3647-5p	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1465301	hsa-miR-3660	CLIP-seq
MIRT1465302	hsa-miR-3667-5p	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT2139941	hsa-miR-384	CLIP-seq
MIRT1465314	hsa-miR-411	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465322	hsa-miR-4526	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1465328	hsa-miR-4762-5p	CLIP-seq
MIRT1465333	hsa-miR-486-3p	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT1465336	hsa-miR-499-5p	CLIP-seq
MIRT1465339	hsa-miR-513a-5p	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT1465348	hsa-miR-541	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT1465366	hsa-miR-629	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1465368	hsa-miR-654-5p	CLIP-seq
MIRT1465371	hsa-miR-9	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465373	hsa-miR-935	CLIP-seq
MIRT1465374	hsa-miR-936	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465260	hsa-miR-149	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465269	hsa-miR-198	CLIP-seq
MIRT1465271	hsa-miR-208a	CLIP-seq
MIRT1465272	hsa-miR-208b	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465289	hsa-miR-3157-5p	CLIP-seq
MIRT1555281	hsa-miR-3174	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT1465297	hsa-miR-3647-3p	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1555282	hsa-miR-3659	CLIP-seq
MIRT1465302	hsa-miR-3667-5p	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465305	hsa-miR-369-3p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT1465312	hsa-miR-374c	CLIP-seq
MIRT1555284	hsa-miR-3921	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1555285	hsa-miR-4653-5p	CLIP-seq
MIRT1555286	hsa-miR-4658	CLIP-seq
MIRT1465324	hsa-miR-4666-5p	CLIP-seq
MIRT1465325	hsa-miR-4690-3p	CLIP-seq
MIRT1555287	hsa-miR-4766-5p	CLIP-seq
MIRT1465331	hsa-miR-4794	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT1465336	hsa-miR-499-5p	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT1465351	hsa-miR-548ah	CLIP-seq
MIRT1555289	hsa-miR-548t	CLIP-seq
MIRT1555290	hsa-miR-574-5p	CLIP-seq
MIRT1555291	hsa-miR-593	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1465369	hsa-miR-655	CLIP-seq
MIRT1465370	hsa-miR-665	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT1465246	hsa-miR-1185	CLIP-seq
MIRT1465247	hsa-miR-1255a	CLIP-seq
MIRT1465248	hsa-miR-1255b	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465250	hsa-miR-1283	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465257	hsa-miR-141	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465267	hsa-miR-188-5p	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465270	hsa-miR-200a	CLIP-seq
MIRT2139938	hsa-miR-204	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT2139939	hsa-miR-211	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT2441572	hsa-miR-3178	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT2360567	hsa-miR-323-3p	CLIP-seq
MIRT1465291	hsa-miR-335	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465295	hsa-miR-3605-5p	CLIP-seq
MIRT1465298	hsa-miR-3647-5p	CLIP-seq
MIRT1465299	hsa-miR-3653	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465303	hsa-miR-3679-5p	CLIP-seq
MIRT1465304	hsa-miR-3686	CLIP-seq
MIRT2360568	hsa-miR-370	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT2139941	hsa-miR-384	CLIP-seq
MIRT1465313	hsa-miR-410	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT1465317	hsa-miR-4261	CLIP-seq
MIRT1465319	hsa-miR-4477b	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465326	hsa-miR-4753-5p	CLIP-seq
MIRT2360573	hsa-miR-4763-5p	CLIP-seq
MIRT1465329	hsa-miR-4768-3p	CLIP-seq
MIRT1465330	hsa-miR-4778-5p	CLIP-seq
MIRT1555288	hsa-miR-495	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT1465337	hsa-miR-501-5p	CLIP-seq
MIRT1465341	hsa-miR-519a	CLIP-seq
MIRT1465342	hsa-miR-519b-3p	CLIP-seq
MIRT1465343	hsa-miR-519c-3p	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT1465365	hsa-miR-561	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT2360581	hsa-miR-628-5p	CLIP-seq
MIRT1465366	hsa-miR-629	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1465370	hsa-miR-665	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT2360562	hsa-miR-1193	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT1465251	hsa-miR-129-5p	CLIP-seq
MIRT2139937	hsa-miR-1305	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465267	hsa-miR-188-5p	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465271	hsa-miR-208a	CLIP-seq
MIRT1465272	hsa-miR-208b	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT1465275	hsa-miR-216a	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465287	hsa-miR-3151	CLIP-seq
MIRT1555281	hsa-miR-3174	CLIP-seq
MIRT2441572	hsa-miR-3178	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT2139940	hsa-miR-3200-5p	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465297	hsa-miR-3647-3p	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1555282	hsa-miR-3659	CLIP-seq
MIRT1465302	hsa-miR-3667-5p	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465304	hsa-miR-3686	CLIP-seq
MIRT1465306	hsa-miR-371-5p	CLIP-seq
MIRT1465307	hsa-miR-371b-5p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT1555284	hsa-miR-3921	CLIP-seq
MIRT1465313	hsa-miR-410	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT2139942	hsa-miR-4251	CLIP-seq
MIRT1465316	hsa-miR-4260	CLIP-seq
MIRT1465318	hsa-miR-4282	CLIP-seq
MIRT2139943	hsa-miR-4329	CLIP-seq
MIRT2139944	hsa-miR-4428	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1555285	hsa-miR-4653-5p	CLIP-seq
MIRT1555286	hsa-miR-4658	CLIP-seq
MIRT1465324	hsa-miR-4666-5p	CLIP-seq
MIRT2139945	hsa-miR-4683	CLIP-seq
MIRT2360570	hsa-miR-4694-3p	CLIP-seq
MIRT1555287	hsa-miR-4766-5p	CLIP-seq
MIRT1465330	hsa-miR-4778-5p	CLIP-seq
MIRT1465332	hsa-miR-4804-3p	CLIP-seq
MIRT1465333	hsa-miR-486-3p	CLIP-seq
MIRT1555288	hsa-miR-495	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT2139946	hsa-miR-498	CLIP-seq
MIRT1465336	hsa-miR-499-5p	CLIP-seq
MIRT1465338	hsa-miR-511	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT2360576	hsa-miR-539	CLIP-seq
MIRT1465348	hsa-miR-541	CLIP-seq
MIRT1465351	hsa-miR-548ah	CLIP-seq
MIRT1465361	hsa-miR-548n	CLIP-seq
MIRT1555289	hsa-miR-548t	CLIP-seq
MIRT1555290	hsa-miR-574-5p	CLIP-seq
MIRT1555291	hsa-miR-593	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1465368	hsa-miR-654-5p	CLIP-seq
MIRT1465371	hsa-miR-9	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq
MIRT1465373	hsa-miR-935	CLIP-seq
MIRT1465244	hsa-miR-106a	CLIP-seq
MIRT1465245	hsa-miR-106b	CLIP-seq
MIRT2360562	hsa-miR-1193	CLIP-seq
MIRT1555278	hsa-miR-1267	CLIP-seq
MIRT1465249	hsa-miR-128	CLIP-seq
MIRT1465251	hsa-miR-129-5p	CLIP-seq
MIRT2139937	hsa-miR-1305	CLIP-seq
MIRT1465252	hsa-miR-130a	CLIP-seq
MIRT1465253	hsa-miR-130b	CLIP-seq
MIRT1465254	hsa-miR-134	CLIP-seq
MIRT1465255	hsa-miR-135a	CLIP-seq
MIRT1465256	hsa-miR-135b	CLIP-seq
MIRT1555279	hsa-miR-136	CLIP-seq
MIRT1465258	hsa-miR-148a	CLIP-seq
MIRT1465259	hsa-miR-148b	CLIP-seq
MIRT1465261	hsa-miR-152	CLIP-seq
MIRT1465262	hsa-miR-15a	CLIP-seq
MIRT1465263	hsa-miR-15b	CLIP-seq
MIRT1465264	hsa-miR-16	CLIP-seq
MIRT1465265	hsa-miR-17	CLIP-seq
MIRT1465267	hsa-miR-188-5p	CLIP-seq
MIRT1465268	hsa-miR-195	CLIP-seq
MIRT1465271	hsa-miR-208a	CLIP-seq
MIRT1465272	hsa-miR-208b	CLIP-seq
MIRT1465273	hsa-miR-20a	CLIP-seq
MIRT1465274	hsa-miR-20b	CLIP-seq
MIRT1465275	hsa-miR-216a	CLIP-seq
MIRT1465277	hsa-miR-23a	CLIP-seq
MIRT1465278	hsa-miR-23b	CLIP-seq
MIRT1555280	hsa-miR-2467-3p	CLIP-seq
MIRT1465281	hsa-miR-301a	CLIP-seq
MIRT1465282	hsa-miR-301b	CLIP-seq
MIRT1465283	hsa-miR-302a	CLIP-seq
MIRT1465284	hsa-miR-302b	CLIP-seq
MIRT1465285	hsa-miR-302c	CLIP-seq
MIRT1465286	hsa-miR-302d	CLIP-seq
MIRT1465287	hsa-miR-3151	CLIP-seq
MIRT1555281	hsa-miR-3174	CLIP-seq
MIRT2441572	hsa-miR-3178	CLIP-seq
MIRT1465290	hsa-miR-3184	CLIP-seq
MIRT2139940	hsa-miR-3200-5p	CLIP-seq
MIRT1465293	hsa-miR-34a	CLIP-seq
MIRT1465297	hsa-miR-3647-3p	CLIP-seq
MIRT1465300	hsa-miR-3658	CLIP-seq
MIRT1555282	hsa-miR-3659	CLIP-seq
MIRT1465302	hsa-miR-3667-5p	CLIP-seq
MIRT1555283	hsa-miR-3678-3p	CLIP-seq
MIRT1465304	hsa-miR-3686	CLIP-seq
MIRT1465306	hsa-miR-371-5p	CLIP-seq
MIRT1465307	hsa-miR-371b-5p	CLIP-seq
MIRT1465308	hsa-miR-372	CLIP-seq
MIRT1465309	hsa-miR-373	CLIP-seq
MIRT1555284	hsa-miR-3921	CLIP-seq
MIRT1465313	hsa-miR-410	CLIP-seq
MIRT1465315	hsa-miR-424	CLIP-seq
MIRT2139942	hsa-miR-4251	CLIP-seq
MIRT1465316	hsa-miR-4260	CLIP-seq
MIRT1465318	hsa-miR-4282	CLIP-seq
MIRT2139943	hsa-miR-4329	CLIP-seq
MIRT2139944	hsa-miR-4428	CLIP-seq
MIRT1465320	hsa-miR-449b	CLIP-seq
MIRT1465321	hsa-miR-4503	CLIP-seq
MIRT1465323	hsa-miR-454	CLIP-seq
MIRT1555285	hsa-miR-4653-5p	CLIP-seq
MIRT1555286	hsa-miR-4658	CLIP-seq
MIRT1465324	hsa-miR-4666-5p	CLIP-seq
MIRT2139945	hsa-miR-4683	CLIP-seq
MIRT2360570	hsa-miR-4694-3p	CLIP-seq
MIRT1555287	hsa-miR-4766-5p	CLIP-seq
MIRT1465330	hsa-miR-4778-5p	CLIP-seq
MIRT1465333	hsa-miR-486-3p	CLIP-seq
MIRT1555288	hsa-miR-495	CLIP-seq
MIRT1465334	hsa-miR-497	CLIP-seq
MIRT2139946	hsa-miR-498	CLIP-seq
MIRT1465336	hsa-miR-499-5p	CLIP-seq
MIRT1465338	hsa-miR-511	CLIP-seq
MIRT1465344	hsa-miR-519d	CLIP-seq
MIRT1465346	hsa-miR-520g	CLIP-seq
MIRT2360576	hsa-miR-539	CLIP-seq
MIRT1465348	hsa-miR-541	CLIP-seq
MIRT1465351	hsa-miR-548ah	CLIP-seq
MIRT1465361	hsa-miR-548n	CLIP-seq
MIRT1555289	hsa-miR-548t	CLIP-seq
MIRT1555290	hsa-miR-574-5p	CLIP-seq
MIRT1555291	hsa-miR-593	CLIP-seq
MIRT1555292	hsa-miR-627	CLIP-seq
MIRT1465367	hsa-miR-642b	CLIP-seq
MIRT1465368	hsa-miR-654-5p	CLIP-seq
MIRT1465371	hsa-miR-9	CLIP-seq
MIRT1555293	hsa-miR-924	CLIP-seq
MIRT1465372	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
FOXO1	Repression	23803610
FOXO3	Activation	20656682
HDAC1	Repression	19351825
HDAC10	Repression	20680488
KLF6	Unknown	19808645
MED23	Unknown	12543799
MLXIPL	Activation	23803610
PPARA	Repression	18848838
PPARG	Unknown	19808645
RBMX	Activation	16707624

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0004857	Function	Enzyme inhibitor activity	IDA	17603038
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	10814541, 14632196, 17260951, 23880345, 26919541, 28514442, 32296183, 38270169
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14632196
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006606	Process	Protein import into nucleus	IEA
GO:0006954	Process	Inflammatory response	TAS	29653364
GO:0006979	Process	Response to oxidative stress	IDA	17603038
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0015031	Process	Protein transport	IBA
GO:0030216	Process	Keratinocyte differentiation	IDA	14632196
GO:0031625	Function	Ubiquitin protein ligase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	20068034
GO:0032355	Process	Response to estradiol	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0051782	Process	Negative regulation of cell division	IDA	18541147
GO:0071228	Process	Cellular response to tumor cell	IDA	18541147
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	TAS	29653364

Other IDs

• MIM: 606599
• HGNC: 16952
• e!Ensembl: ENSG00000265972

Protein

• UniProt ID: Q9H3M7
• Protein name: Thioredoxin-interacting protein (Thioredoxin-binding protein 2) (Vitamin D3 up-regulated protein 1)
• Protein function: May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability (PubMed:17603038). Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translo
• PDB: 4GEI, 4GEJ, 4GFX, 4LL1, 4LL4, 4ROF, 4ROJ, 5CQ2, 5DF6, 5DWS, 5DZD
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00339	Arrestin_N	10 → 152	Arrestin (or S-antigen), N-terminal domain	Domain
  PF02752	Arrestin_C	174 → 300	Arrestin (or S-antigen), C-terminal domain	Domain

• Sequence:

  MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVIVEVCEVTRVKAVRILACGVAKVLWMQGS
  QQCKQTSEYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
  VDYWVKAFLDRPSQPTQETKKNFEVVDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
  SARIDRKGFCEGDEISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
  HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
  GLSSRTSSMASRTSSEMSWVDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQD
  SPIFMYAPEFKFMPPPTYTEVDPCILNNNVQ

• Sequence length: 391

Pathways

KEGG:

NOD-like receptor signaling pathway

Reactome:

The NLRP3 inflammasome
Purinergic signaling in leishmaniasis infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acidosis Lactic	Lactic acidosis	Pubtator	30755400	Associate	★☆☆☆☆ Found in Text Mining only
Acidosis Lactic	Lactic acidosis	Pubtator	38195466	Stimulate	★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	23315031		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	19327827, 21734239		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	12821938		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	29934340		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	14983878		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31615975		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30741672	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34153352, 36422510	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29634349		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30975975		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	24645981		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	39596362	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	36830671	Associate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	29245343, 30034557	Stimulate	★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	36830671	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	29245343, 30034557		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30078003		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30246263, 31518877		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26934991		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24188128		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30246263, 31518877		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23762225		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21771725		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	30741672	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	26829886		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20584310, 25812606, 25870263, 26122224, 26196741, 29524408, 30042414		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17555594, 20584310, 25605021, 25870263, 34614512	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32511893, 38229544	Inhibit	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27456940	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27437069, 33795533, 35640677	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	29955142	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24112473, 34324544, 37156819	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	29955142	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21771725		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22223368, 30390072		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34433833	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39526479	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21543874, 36012132	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31749214		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	33161770	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	29854083		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28851669		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30372683		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31782782		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31782782		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29884908		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11748459		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12553030, 17671698		★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	29955142		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31043707, 31629934		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22201682, 27470124, 27807222, 29245343		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27470124		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	27470124, 32039564	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	36830671	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	29245343, 33026112	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27470124		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	22450549, 23691179		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	23691179	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30372683, 30741672		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	29110407		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	14531794, 17381501, 18793170, 19118408, 21364670, 22236479, 22883234, 23647015, 23975026, 24198286, 24492284, 24720336, 24925443, 25003952, 25391656, 26858253, 28025459, 28492550, 28502980, 29203232, 29282201, 29356688, 29980378, 29988125, 30372683, 30755400, 30765336, 31505737, 31835423		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	37038114	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	14531794, 17381501, 18793170, 19118408, 19808645, 21364670, 22236479, 22883234, 23647015, 23975026, 24198286, 24492284, 24720336, 24925443, 25003952, 25391656, 26858253, 28025459, 28137209, 28492550, 28502980, 29203232, 29282201, 29356688, 29980378, 29988125, 30372683, 30755400, 30765336, 30939192, 31505737, 31835423		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	15128745		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21543874, 22236479, 26095709, 27274779, 27437069, 29325019, 30755400, 34726138, 35164795, 35607770, 38054509	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30741672, 32912630	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36604111	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	25726203, 26101197, 27148772, 27470124, 30107520, 30649532, 33239708, 34596421, 34726138, 35165382, 36651294, 38137029, 38538307	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	23647015, 26480949, 28890350, 28988346, 29077742, 29980378, 30168649		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17381501, 17472435, 19214472, 20299477, 25625584, 26095709, 26101197, 26433941, 26643952, 26823690, 26858253, 28988346, 29077742, 29356688, 29980378, 31691802, 31848914		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	17472435		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	24925443, 27037370		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33161510, 40076459	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	14531794, 19808645, 24492284, 26480949, 26806835, 29433676, 29884908, 30142540, 30746698, 30962862, 31017263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	17582205		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	30733849		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	21364670, 26025281, 26763822, 27785530, 28492550, 30733849, 31023645, 31649499		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24645981		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	16081686		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29401599, 30733849		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	31519581		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	20172870		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	20172870	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28325828		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28325828		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	29934340		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25003952		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28499273, 30387131		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	24024162	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	36727359	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23387972, 37175448	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28781647		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28781647		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28781647		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28099758		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	29394934		★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	26095709	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27437069	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21385932	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	36830671	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	14531794, 17381501, 17555594, 19214472, 20299477, 21270263, 24720336, 26643952, 26806835, 27037370, 27162351		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	17555594	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27162351, 27437069, 34726138, 35165382	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	23691179		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	17381501		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	14991056, 15136067, 15368498		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22236479	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	36830671	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	22236479		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	18974273, 28591573		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	16723126, 25854388	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21192937, 37246768	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35811256	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29110407		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31618209	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23691179	Stimulate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35165382, 36534481, 36782224	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29649568, 30592131		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	30592131, 34603601	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30733849		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29477360		★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	29339473		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	35156506	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	19327827		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29996811, 32511893, 36322827	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	19327827, 21734239, 29996811		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	14983878		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	32249461	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19052253, 24112473, 26037596, 26829886, 28440491, 28789347, 30627326		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30197023		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33760130, 35811256, 35887091	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28781647		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	24885895		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20584310, 25812606, 25870263, 26122224, 26196741, 29524408, 30042414		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	31519581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28325828		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	12553030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28440491		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22223368, 30390072		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18376310, 24720336		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17071605, 19052253, 23762225, 28029659, 30103944		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	24645981, 28440491		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21771725		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12553030, 16723126, 17671698, 18376310, 19351825, 21192937, 21771725, 21964212, 26196741, 26315267, 26829886, 28440491, 29339473, 29524408, 29534438, 30410860		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31782782		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11748459		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28243945, 28843270		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24885895	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	31739726, 34645728, 34780523	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31739726		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36684674	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28844667		★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	32556351	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30261287		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	22201682, 27807222		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	29955142	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12553030, 17071605, 18376310, 19824090, 21771725, 23172669, 23315031, 24112473, 24645981, 25844669, 26829886, 28029659, 28243945, 28440491, 28781647, 28821631, 29524408, 29934340, 29955142, 30336978, 30390072, 30410860, 31578830		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29884908		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26829886		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30741672, 38054509	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24283717, 29488135, 31443163, 31649499		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30733849		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	17582205		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23647015, 25003952, 28499273, 30429827, 30861601		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25854388, 29328484, 30390072, 31578830		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	30387131		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	29955142		★☆☆☆☆ Found in Text Mining only
Nuchal bleb, familial	Nuchal Bleb	BEFREE	15368498		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27274779	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	29524408		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33161770	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19932085		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32023548	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18376310, 24720336		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18376310		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28765935, 33749639, 40294979	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38229544	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28755477, 30799274		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	30799274	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	40294979	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22904171, 33224973	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30372683		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29852184		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	29203232		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17071605, 19052253, 23762225, 28029659, 30103944		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12189205		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17071605, 28651973	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31043707, 31629934		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29884908		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	30962862		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25329456		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	27510506		★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	37246768	Inhibit	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31173172		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29031534		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23403885	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23403885		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25003952, 29482933		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20680488, 23112551, 36418919	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	30741672	Stimulate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28420192, 28490373, 29905889, 31791369		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	24645981, 28440491		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	24645981, 28440491		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	38229544	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	20976176	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25870263		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	25870263, 32356386, 36930677	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35414060	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17671698		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	17671698		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33795533	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	22531461		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37176057	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	36604111	Associate	★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	BEFREE	22883234		★☆☆☆☆ Found in Text Mining only