Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10626
Gene name	Tripartite motif containing 16
Gene symbol	TRIM16
Synonyms (NCBI Gene)	EBBP
Chromosome	17
Chromosome location	17p12
Summary	The protein encoded by this gene is a tripartite motif (TRIM) family member that contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. While it lacks a RING domain found in other TRIM protei

217

Show/Hide all (217)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017852	hsa-miR-335-5p	Microarray	18185580
MIRT1453184	hsa-miR-1207-5p	CLIP-seq
MIRT1453185	hsa-miR-1254	CLIP-seq
MIRT1453186	hsa-miR-1283	CLIP-seq
MIRT1453187	hsa-miR-1285	CLIP-seq
MIRT1453188	hsa-miR-1343	CLIP-seq
MIRT1453189	hsa-miR-3116	CLIP-seq
MIRT1453190	hsa-miR-3122	CLIP-seq
MIRT1453191	hsa-miR-3159	CLIP-seq
MIRT1453192	hsa-miR-3167	CLIP-seq
MIRT1453193	hsa-miR-3187-5p	CLIP-seq
MIRT1453194	hsa-miR-3613-3p	CLIP-seq
MIRT1453195	hsa-miR-3689a-3p	CLIP-seq
MIRT1453196	hsa-miR-3689c	CLIP-seq
MIRT1453197	hsa-miR-371-5p	CLIP-seq
MIRT1453198	hsa-miR-371b-5p	CLIP-seq
MIRT1453199	hsa-miR-380	CLIP-seq
MIRT1453200	hsa-miR-3913-5p	CLIP-seq
MIRT1453201	hsa-miR-3925-3p	CLIP-seq
MIRT1453202	hsa-miR-3926	CLIP-seq
MIRT1453203	hsa-miR-4252	CLIP-seq
MIRT1453204	hsa-miR-4327	CLIP-seq
MIRT1453205	hsa-miR-4433	CLIP-seq
MIRT1453206	hsa-miR-4459	CLIP-seq
MIRT1453207	hsa-miR-4477b	CLIP-seq
MIRT1453208	hsa-miR-4514	CLIP-seq
MIRT1453209	hsa-miR-4692	CLIP-seq
MIRT1453210	hsa-miR-4709-5p	CLIP-seq
MIRT1453211	hsa-miR-4711-5p	CLIP-seq
MIRT1453212	hsa-miR-4728-5p	CLIP-seq
MIRT1453213	hsa-miR-4763-3p	CLIP-seq
MIRT1453214	hsa-miR-4768-3p	CLIP-seq
MIRT1453215	hsa-miR-548s	CLIP-seq
MIRT1453216	hsa-miR-607	CLIP-seq
MIRT1453217	hsa-miR-612	CLIP-seq
MIRT1453218	hsa-miR-661	CLIP-seq
MIRT1453219	hsa-miR-766	CLIP-seq
MIRT1453220	hsa-miR-876-5p	CLIP-seq
MIRT1453221	hsa-miR-940	CLIP-seq
MIRT2135753	hsa-miR-1273e	CLIP-seq
MIRT2135754	hsa-miR-128	CLIP-seq
MIRT1453187	hsa-miR-1285	CLIP-seq
MIRT1453188	hsa-miR-1343	CLIP-seq
MIRT2135755	hsa-miR-1827	CLIP-seq
MIRT2135756	hsa-miR-2964a-3p	CLIP-seq
MIRT2135757	hsa-miR-302f	CLIP-seq
MIRT1453190	hsa-miR-3122	CLIP-seq
MIRT2135758	hsa-miR-3157-5p	CLIP-seq
MIRT1453193	hsa-miR-3187-5p	CLIP-seq
MIRT2135759	hsa-miR-3545-3p	CLIP-seq
MIRT1453195	hsa-miR-3689a-3p	CLIP-seq
MIRT1453196	hsa-miR-3689c	CLIP-seq
MIRT2135760	hsa-miR-378g	CLIP-seq
MIRT1453200	hsa-miR-3913-5p	CLIP-seq
MIRT2135761	hsa-miR-3929	CLIP-seq
MIRT2135762	hsa-miR-4302	CLIP-seq
MIRT2135763	hsa-miR-4314	CLIP-seq
MIRT2135764	hsa-miR-4419b	CLIP-seq
MIRT1453205	hsa-miR-4433	CLIP-seq
MIRT1453206	hsa-miR-4459	CLIP-seq
MIRT1453207	hsa-miR-4477b	CLIP-seq
MIRT2135765	hsa-miR-4478	CLIP-seq
MIRT2135766	hsa-miR-4486	CLIP-seq
MIRT2135767	hsa-miR-4504	CLIP-seq
MIRT2135768	hsa-miR-4649-3p	CLIP-seq
MIRT2135769	hsa-miR-4680-5p	CLIP-seq
MIRT2135770	hsa-miR-4691-3p	CLIP-seq
MIRT1453210	hsa-miR-4709-5p	CLIP-seq
MIRT1453211	hsa-miR-4711-5p	CLIP-seq
MIRT2135771	hsa-miR-4722-5p	CLIP-seq
MIRT1453212	hsa-miR-4728-5p	CLIP-seq
MIRT1453214	hsa-miR-4768-3p	CLIP-seq
MIRT2135772	hsa-miR-485-5p	CLIP-seq
MIRT2135773	hsa-miR-542-3p	CLIP-seq
MIRT1453217	hsa-miR-612	CLIP-seq
MIRT1453221	hsa-miR-940	CLIP-seq
MIRT2356895	hsa-miR-1207-3p	CLIP-seq
MIRT1453184	hsa-miR-1207-5p	CLIP-seq
MIRT1453185	hsa-miR-1254	CLIP-seq
MIRT2135753	hsa-miR-1273e	CLIP-seq
MIRT2135754	hsa-miR-128	CLIP-seq
MIRT1453187	hsa-miR-1285	CLIP-seq
MIRT2356896	hsa-miR-1298	CLIP-seq
MIRT1453188	hsa-miR-1343	CLIP-seq
MIRT2135755	hsa-miR-1827	CLIP-seq
MIRT2356897	hsa-miR-2278	CLIP-seq
MIRT2135756	hsa-miR-2964a-3p	CLIP-seq
MIRT2356898	hsa-miR-29a	CLIP-seq
MIRT2356899	hsa-miR-29b	CLIP-seq
MIRT2356900	hsa-miR-29c	CLIP-seq
MIRT2135757	hsa-miR-302f	CLIP-seq
MIRT2356901	hsa-miR-3065-3p	CLIP-seq
MIRT1453189	hsa-miR-3116	CLIP-seq
MIRT1453190	hsa-miR-3122	CLIP-seq
MIRT2356902	hsa-miR-3135b	CLIP-seq
MIRT1453193	hsa-miR-3187-5p	CLIP-seq
MIRT2135759	hsa-miR-3545-3p	CLIP-seq
MIRT1453195	hsa-miR-3689a-3p	CLIP-seq
MIRT1453196	hsa-miR-3689c	CLIP-seq
MIRT2135760	hsa-miR-378g	CLIP-seq
MIRT1453200	hsa-miR-3913-5p	CLIP-seq
MIRT1453201	hsa-miR-3925-3p	CLIP-seq
MIRT1453202	hsa-miR-3926	CLIP-seq
MIRT2135761	hsa-miR-3929	CLIP-seq
MIRT1453203	hsa-miR-4252	CLIP-seq
MIRT2135762	hsa-miR-4302	CLIP-seq
MIRT2356903	hsa-miR-4307	CLIP-seq
MIRT2356904	hsa-miR-4311	CLIP-seq
MIRT2135763	hsa-miR-4314	CLIP-seq
MIRT2135764	hsa-miR-4419b	CLIP-seq
MIRT2356905	hsa-miR-4434	CLIP-seq
MIRT1453207	hsa-miR-4477b	CLIP-seq
MIRT2135765	hsa-miR-4478	CLIP-seq
MIRT2135766	hsa-miR-4486	CLIP-seq
MIRT2135767	hsa-miR-4504	CLIP-seq
MIRT2356906	hsa-miR-4516	CLIP-seq
MIRT2356907	hsa-miR-4531	CLIP-seq
MIRT2135768	hsa-miR-4649-3p	CLIP-seq
MIRT2135769	hsa-miR-4680-5p	CLIP-seq
MIRT1453210	hsa-miR-4709-5p	CLIP-seq
MIRT2135771	hsa-miR-4722-5p	CLIP-seq
MIRT1453212	hsa-miR-4728-5p	CLIP-seq
MIRT1453213	hsa-miR-4763-3p	CLIP-seq
MIRT1453214	hsa-miR-4768-3p	CLIP-seq
MIRT2356908	hsa-miR-4802-5p	CLIP-seq
MIRT2135772	hsa-miR-485-5p	CLIP-seq
MIRT2135773	hsa-miR-542-3p	CLIP-seq
MIRT2356909	hsa-miR-548p	CLIP-seq
MIRT1453215	hsa-miR-548s	CLIP-seq
MIRT1453217	hsa-miR-612	CLIP-seq
MIRT2356910	hsa-miR-646	CLIP-seq
MIRT1453218	hsa-miR-661	CLIP-seq
MIRT1453219	hsa-miR-766	CLIP-seq
MIRT2356911	hsa-miR-767-5p	CLIP-seq
MIRT1453221	hsa-miR-940	CLIP-seq
MIRT2135754	hsa-miR-128	CLIP-seq
MIRT1453187	hsa-miR-1285	CLIP-seq
MIRT1453188	hsa-miR-1343	CLIP-seq
MIRT1453190	hsa-miR-3122	CLIP-seq
MIRT2135758	hsa-miR-3157-5p	CLIP-seq
MIRT1453193	hsa-miR-3187-5p	CLIP-seq
MIRT1453195	hsa-miR-3689a-3p	CLIP-seq
MIRT1453196	hsa-miR-3689c	CLIP-seq
MIRT2135760	hsa-miR-378g	CLIP-seq
MIRT1453199	hsa-miR-380	CLIP-seq
MIRT1453200	hsa-miR-3913-5p	CLIP-seq
MIRT2135763	hsa-miR-4314	CLIP-seq
MIRT1453207	hsa-miR-4477b	CLIP-seq
MIRT2135766	hsa-miR-4486	CLIP-seq
MIRT2135770	hsa-miR-4691-3p	CLIP-seq
MIRT1453212	hsa-miR-4728-5p	CLIP-seq
MIRT1453217	hsa-miR-612	CLIP-seq
MIRT2462340	hsa-miR-3675-3p	CLIP-seq
MIRT2462341	hsa-miR-4684-5p	CLIP-seq
MIRT2462342	hsa-miR-548c-3p	CLIP-seq
MIRT1453184	hsa-miR-1207-5p	CLIP-seq
MIRT1453185	hsa-miR-1254	CLIP-seq
MIRT1453187	hsa-miR-1285	CLIP-seq
MIRT2650333	hsa-miR-186	CLIP-seq
MIRT1453189	hsa-miR-3116	CLIP-seq
MIRT1453190	hsa-miR-3122	CLIP-seq
MIRT2650334	hsa-miR-3150b-3p	CLIP-seq
MIRT1453193	hsa-miR-3187-5p	CLIP-seq
MIRT1453194	hsa-miR-3613-3p	CLIP-seq
MIRT2462340	hsa-miR-3675-3p	CLIP-seq
MIRT1453195	hsa-miR-3689a-3p	CLIP-seq
MIRT1453196	hsa-miR-3689c	CLIP-seq
MIRT1453197	hsa-miR-371-5p	CLIP-seq
MIRT1453198	hsa-miR-371b-5p	CLIP-seq
MIRT1453199	hsa-miR-380	CLIP-seq
MIRT1453200	hsa-miR-3913-5p	CLIP-seq
MIRT1453201	hsa-miR-3925-3p	CLIP-seq
MIRT1453202	hsa-miR-3926	CLIP-seq
MIRT1453203	hsa-miR-4252	CLIP-seq
MIRT1453205	hsa-miR-4433	CLIP-seq
MIRT2650335	hsa-miR-4455	CLIP-seq
MIRT1453206	hsa-miR-4459	CLIP-seq
MIRT2462341	hsa-miR-4684-5p	CLIP-seq
MIRT1453210	hsa-miR-4709-5p	CLIP-seq
MIRT1453211	hsa-miR-4711-5p	CLIP-seq
MIRT1453212	hsa-miR-4728-5p	CLIP-seq
MIRT2650336	hsa-miR-4736	CLIP-seq
MIRT1453213	hsa-miR-4763-3p	CLIP-seq
MIRT1453214	hsa-miR-4768-3p	CLIP-seq
MIRT2650337	hsa-miR-4784	CLIP-seq
MIRT2462342	hsa-miR-548c-3p	CLIP-seq
MIRT1453215	hsa-miR-548s	CLIP-seq
MIRT2650338	hsa-miR-609	CLIP-seq
MIRT1453217	hsa-miR-612	CLIP-seq
MIRT1453218	hsa-miR-661	CLIP-seq
MIRT1453219	hsa-miR-766	CLIP-seq
MIRT1453185	hsa-miR-1254	CLIP-seq
MIRT1453187	hsa-miR-1285	CLIP-seq
MIRT1453189	hsa-miR-3116	CLIP-seq
MIRT1453190	hsa-miR-3122	CLIP-seq
MIRT1453193	hsa-miR-3187-5p	CLIP-seq
MIRT2462340	hsa-miR-3675-3p	CLIP-seq
MIRT1453195	hsa-miR-3689a-3p	CLIP-seq
MIRT1453196	hsa-miR-3689c	CLIP-seq
MIRT1453199	hsa-miR-380	CLIP-seq
MIRT1453200	hsa-miR-3913-5p	CLIP-seq
MIRT1453201	hsa-miR-3925-3p	CLIP-seq
MIRT1453202	hsa-miR-3926	CLIP-seq
MIRT1453203	hsa-miR-4252	CLIP-seq
MIRT1453205	hsa-miR-4433	CLIP-seq
MIRT2650335	hsa-miR-4455	CLIP-seq
MIRT1453206	hsa-miR-4459	CLIP-seq
MIRT2462341	hsa-miR-4684-5p	CLIP-seq
MIRT1453211	hsa-miR-4711-5p	CLIP-seq
MIRT1453212	hsa-miR-4728-5p	CLIP-seq
MIRT1453214	hsa-miR-4768-3p	CLIP-seq
MIRT2462342	hsa-miR-548c-3p	CLIP-seq
MIRT1453215	hsa-miR-548s	CLIP-seq
MIRT2650338	hsa-miR-609	CLIP-seq
MIRT1453217	hsa-miR-612	CLIP-seq
MIRT1453218	hsa-miR-661	CLIP-seq
MIRT1453219	hsa-miR-766	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IDA	16636064
GO:0005515	Function	Protein binding	IPI	16575408, 20729920, 21044950, 25127057, 28514442, 33961781
GO:0005737	Component	Cytoplasm	IDA	9817599, 11919186, 16575408
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016605	Component	PML body	IDA	16636064
GO:0016740	Function	Transferase activity	IEA
GO:0019966	Function	Interleukin-1 binding	IPI	16575408
GO:0032089	Function	NACHT domain binding	IPI	16575408
GO:0032526	Process	Response to retinoic acid	IEP	16636064
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	16575408
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IDA	11919186
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16636064, 19147277
GO:0046872	Function	Metal ion binding	IEA
GO:0048386	Process	Positive regulation of retinoic acid receptor signaling pathway	IDA	16636064
GO:0060416	Process	Response to growth hormone	IDA	11919186
GO:0061630	Function	Ubiquitin protein ligase activity	IEA

MIM	HGNC	e!Ensembl
609505	17241	ENSG00000221926

O95361

Protein name

Tripartite motif-containing protein 16 (EC 2.3.2.27) (E3 ubiquitin-protein ligase TRIM16) (Estrogen-responsive B box protein)

Protein function

E3 ubiquitin ligase that plays an essential role in the organization of autophagic response and ubiquitination upon lysosomal and phagosomal damages. Plays a role in the stress-induced biogenesis and degradation of protein aggresomes by regulati

PDB

7QS3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00643	zf-B_box	126 → 165	B-box zinc finger	Domain
PF13765	PRY	375 → 424	SPRY-associated domain	Family
PF00622	SPRY	428 → 549	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highest levels found in testis, ovary, small intestine, colon, placenta, heart, skeletal muscle and mammary gland. More highly expressed in the fetus than in the corresponding adult tissues. Expressed in basal keratinocytes.

Sequence

MAELDLMAPGPLPRATAQPPAPLSPDSGSPSPDSGSASPVEEEDVGSSEKLGRETEEQDS
DSAEQGDPAGEGKEVLCDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLT
EPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQ
LDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEK
EQAALSQANGIKAHLEYRSAEMEKSKQELERMAAISNTVQFLEEYCKFKNTEDITFPSVY
VGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAVVQRKYWTSKP
EPSTREQFLQYAYDITFDPDTAHKYLRLQEENRKVTNTTPWEHPYPDLPSRFLHWRQVLS
QQSLYLHRYYFEVEIFGAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWY
SDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAFWLSKKE
NAIRIVDLGEEPEKPAPSLVGTAP

Sequence length

564

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (43)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	16636064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	27748839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Gouty	Gouty arthritis	Pubtator	39511617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26718507, 26902425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23404198, 36180926	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22009481	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26718507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33173411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22009481, 25333256	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23404198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27737724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28222026	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	16636064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26892350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25333256	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34319022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26718507, 26902425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27737724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27748839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31342168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25866896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26718507, 26902425, 30806139		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25333256, 31342168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25333256, 33184347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26892350, 26902425, 27748839, 29295721, 31812473, 9817599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22009481, 23404198, 25333256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23422002, 25333256, 26902425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	30143514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25843803, 29295721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31521826		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27737724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27737724	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	BEFREE	31342168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27748839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27748839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27748839, 32102520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34135057	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23341783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	22009481	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31812473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	25333256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25866896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34452557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM16 (tripartite motif containing 16)