Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10625
Gene name	Influenza virus NS1A binding protein
Gene symbol	IVNS1ABP
Synonyms (NCBI Gene)	ARA3FLARA3HSPC068IMD70KLHL39ND1NS-1NS1-BPNS1BP
Chromosome	1
Chromosome location	1q25.3

259

Show/Hide all (259)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026996	hsa-miR-103a-3p	Sequencing	20371350
MIRT029013	hsa-miR-26b-5p	Microarray	19088304
MIRT030741	hsa-miR-21-5p	Microarray	18591254
MIRT031511	hsa-miR-16-5p	Sequencing	20371350
MIRT044680	hsa-miR-320a	CLASH	23622248
MIRT475068	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT475067	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031511	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT475066	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT475065	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT475064	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT475063	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT475061	hsa-miR-3201	PAR-CLIP	20371350
MIRT475062	hsa-miR-4791	PAR-CLIP	20371350
MIRT268897	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT475060	hsa-miR-1261	PAR-CLIP	20371350
MIRT061079	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT475059	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT556873	hsa-miR-3189-5p	PAR-CLIP	21572407
MIRT556872	hsa-miR-874-5p	PAR-CLIP	21572407
MIRT556871	hsa-miR-3650	PAR-CLIP	21572407
MIRT556870	hsa-miR-6800-5p	PAR-CLIP	21572407
MIRT556869	hsa-miR-6802-5p	PAR-CLIP	21572407
MIRT556868	hsa-miR-328-3p	PAR-CLIP	21572407
MIRT475068	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT475067	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031511	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT475066	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT475065	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT475064	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT475063	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT475061	hsa-miR-3201	PAR-CLIP	21572407
MIRT475062	hsa-miR-4791	PAR-CLIP	21572407
MIRT268897	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT475060	hsa-miR-1261	PAR-CLIP	21572407
MIRT061079	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT475059	hsa-miR-605-5p	PAR-CLIP	21572407
MIRT485463	hsa-miR-145-5p	PAR-CLIP	23592263
MIRT485462	hsa-miR-5195-3p	PAR-CLIP	23592263
MIRT485461	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT485460	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT485459	hsa-miR-4255	PAR-CLIP	23592263
MIRT485458	hsa-miR-3976	PAR-CLIP	23592263
MIRT485457	hsa-miR-362-5p	PAR-CLIP	23592263
MIRT485456	hsa-miR-500b-5p	PAR-CLIP	23592263
MIRT485455	hsa-miR-501-5p	PAR-CLIP	23592263
MIRT485454	hsa-miR-3121-5p	PAR-CLIP	23592263
MIRT485453	hsa-miR-3659	PAR-CLIP	23592263
MIRT485452	hsa-miR-938	PAR-CLIP	23592263
MIRT485451	hsa-miR-6851-3p	PAR-CLIP	23592263
MIRT475068	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT475067	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT031511	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT475066	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT475065	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT475064	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT475063	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT475061	hsa-miR-3201	PAR-CLIP	23592263
MIRT475062	hsa-miR-4791	PAR-CLIP	23592263
MIRT268897	hsa-miR-3177-5p	PAR-CLIP	23592263
MIRT475060	hsa-miR-1261	PAR-CLIP	23592263
MIRT061079	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT475059	hsa-miR-605-5p	PAR-CLIP	23592263
MIRT475068	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT475067	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT031511	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT475066	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT475065	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT475064	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT475063	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT475061	hsa-miR-3201	PAR-CLIP	20371350
MIRT475062	hsa-miR-4791	PAR-CLIP	20371350
MIRT268897	hsa-miR-3177-5p	PAR-CLIP	20371350
MIRT475060	hsa-miR-1261	PAR-CLIP	20371350
MIRT061079	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT475059	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT556873	hsa-miR-3189-5p	PAR-CLIP	21572407
MIRT556872	hsa-miR-874-5p	PAR-CLIP	21572407
MIRT556871	hsa-miR-3650	PAR-CLIP	21572407
MIRT556870	hsa-miR-6800-5p	PAR-CLIP	21572407
MIRT556869	hsa-miR-6802-5p	PAR-CLIP	21572407
MIRT556868	hsa-miR-328-3p	PAR-CLIP	21572407
MIRT475068	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT475067	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT031511	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT475066	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT475065	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT475064	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT475063	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT475061	hsa-miR-3201	PAR-CLIP	21572407
MIRT475062	hsa-miR-4791	PAR-CLIP	21572407
MIRT268897	hsa-miR-3177-5p	PAR-CLIP	21572407
MIRT475060	hsa-miR-1261	PAR-CLIP	21572407
MIRT061079	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT475059	hsa-miR-605-5p	PAR-CLIP	21572407
MIRT485463	hsa-miR-145-5p	PAR-CLIP	23592263
MIRT485462	hsa-miR-5195-3p	PAR-CLIP	23592263
MIRT485461	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT485460	hsa-miR-7160-3p	PAR-CLIP	23592263
MIRT485459	hsa-miR-4255	PAR-CLIP	23592263
MIRT485458	hsa-miR-3976	PAR-CLIP	23592263
MIRT485457	hsa-miR-362-5p	PAR-CLIP	23592263
MIRT485456	hsa-miR-500b-5p	PAR-CLIP	23592263
MIRT485455	hsa-miR-501-5p	PAR-CLIP	23592263
MIRT485454	hsa-miR-3121-5p	PAR-CLIP	23592263
MIRT485453	hsa-miR-3659	PAR-CLIP	23592263
MIRT485452	hsa-miR-938	PAR-CLIP	23592263
MIRT485451	hsa-miR-6851-3p	PAR-CLIP	23592263
MIRT475068	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT475067	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT031511	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT475066	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT475065	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT475064	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT475063	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT475061	hsa-miR-3201	PAR-CLIP	23592263
MIRT475062	hsa-miR-4791	PAR-CLIP	23592263
MIRT268897	hsa-miR-3177-5p	PAR-CLIP	23592263
MIRT475060	hsa-miR-1261	PAR-CLIP	23592263
MIRT061079	hsa-let-7c-3p	PAR-CLIP	23592263
MIRT475059	hsa-miR-605-5p	PAR-CLIP	23592263
MIRT1075686	hsa-miR-1182	CLIP-seq
MIRT1075687	hsa-miR-1304	CLIP-seq
MIRT1075688	hsa-miR-182	CLIP-seq
MIRT1075689	hsa-miR-193a-5p	CLIP-seq
MIRT1075690	hsa-miR-19a	CLIP-seq
MIRT1075691	hsa-miR-19b	CLIP-seq
MIRT1075692	hsa-miR-203	CLIP-seq
MIRT1075693	hsa-miR-205	CLIP-seq
MIRT1075694	hsa-miR-3120-3p	CLIP-seq
MIRT1075695	hsa-miR-3126-5p	CLIP-seq
MIRT1075696	hsa-miR-3150b-3p	CLIP-seq
MIRT1075697	hsa-miR-33a	CLIP-seq
MIRT1075698	hsa-miR-33b	CLIP-seq
MIRT1075699	hsa-miR-4419a	CLIP-seq
MIRT1075700	hsa-miR-4470	CLIP-seq
MIRT1075701	hsa-miR-4491	CLIP-seq
MIRT1075702	hsa-miR-4510	CLIP-seq
MIRT1075703	hsa-miR-4635	CLIP-seq
MIRT1075704	hsa-miR-4643	CLIP-seq
MIRT1075705	hsa-miR-4652-5p	CLIP-seq
MIRT1075706	hsa-miR-4657	CLIP-seq
MIRT1075707	hsa-miR-466	CLIP-seq
MIRT1075708	hsa-miR-4729	CLIP-seq
MIRT1075709	hsa-miR-4784	CLIP-seq
MIRT1075710	hsa-miR-4789-3p	CLIP-seq
MIRT1075711	hsa-miR-513a-3p	CLIP-seq
MIRT1075712	hsa-miR-526b	CLIP-seq
MIRT1075713	hsa-miR-548l	CLIP-seq
MIRT1075714	hsa-miR-548n	CLIP-seq
MIRT1075715	hsa-miR-633	CLIP-seq
MIRT1075716	hsa-miR-765	CLIP-seq
MIRT2018815	hsa-miR-145	CLIP-seq
MIRT1075692	hsa-miR-203	CLIP-seq
MIRT1075694	hsa-miR-3120-3p	CLIP-seq
MIRT1075696	hsa-miR-3150b-3p	CLIP-seq
MIRT2018816	hsa-miR-3168	CLIP-seq
MIRT1075697	hsa-miR-33a	CLIP-seq
MIRT1075698	hsa-miR-33b	CLIP-seq
MIRT1075703	hsa-miR-4635	CLIP-seq
MIRT1075705	hsa-miR-4652-5p	CLIP-seq
MIRT2018817	hsa-miR-4714-5p	CLIP-seq
MIRT2018818	hsa-miR-4762-3p	CLIP-seq
MIRT1075709	hsa-miR-4784	CLIP-seq
MIRT2018819	hsa-miR-513b	CLIP-seq
MIRT1075712	hsa-miR-526b	CLIP-seq
MIRT2018820	hsa-miR-548aa	CLIP-seq
MIRT2018821	hsa-miR-548ae	CLIP-seq
MIRT2018822	hsa-miR-548aj	CLIP-seq
MIRT2018823	hsa-miR-548am	CLIP-seq
MIRT1075713	hsa-miR-548l	CLIP-seq
MIRT1075714	hsa-miR-548n	CLIP-seq
MIRT2018824	hsa-miR-548x	CLIP-seq
MIRT1075716	hsa-miR-765	CLIP-seq
MIRT2250676	hsa-miR-1264	CLIP-seq
MIRT2250677	hsa-miR-1279	CLIP-seq
MIRT1075687	hsa-miR-1304	CLIP-seq
MIRT2250678	hsa-miR-132	CLIP-seq
MIRT2250679	hsa-miR-15a	CLIP-seq
MIRT2250680	hsa-miR-15b	CLIP-seq
MIRT2250681	hsa-miR-16	CLIP-seq
MIRT1075688	hsa-miR-182	CLIP-seq
MIRT2250682	hsa-miR-195	CLIP-seq
MIRT1075690	hsa-miR-19a	CLIP-seq
MIRT1075691	hsa-miR-19b	CLIP-seq
MIRT1075692	hsa-miR-203	CLIP-seq
MIRT1075693	hsa-miR-205	CLIP-seq
MIRT2250683	hsa-miR-212	CLIP-seq
MIRT2250684	hsa-miR-3064-3p	CLIP-seq
MIRT1075694	hsa-miR-3120-3p	CLIP-seq
MIRT1075695	hsa-miR-3126-5p	CLIP-seq
MIRT2250685	hsa-miR-3163	CLIP-seq
MIRT1075697	hsa-miR-33a	CLIP-seq
MIRT1075698	hsa-miR-33b	CLIP-seq
MIRT2250686	hsa-miR-3682-5p	CLIP-seq
MIRT2250687	hsa-miR-424	CLIP-seq
MIRT2250688	hsa-miR-4251	CLIP-seq
MIRT1075699	hsa-miR-4419a	CLIP-seq
MIRT2250689	hsa-miR-4422	CLIP-seq
MIRT1075700	hsa-miR-4470	CLIP-seq
MIRT1075701	hsa-miR-4491	CLIP-seq
MIRT1075702	hsa-miR-4510	CLIP-seq
MIRT2250690	hsa-miR-455-5p	CLIP-seq
MIRT1075703	hsa-miR-4635	CLIP-seq
MIRT1075704	hsa-miR-4643	CLIP-seq
MIRT1075705	hsa-miR-4652-5p	CLIP-seq
MIRT1075706	hsa-miR-4657	CLIP-seq
MIRT2250691	hsa-miR-4658	CLIP-seq
MIRT1075707	hsa-miR-466	CLIP-seq
MIRT2250692	hsa-miR-4663	CLIP-seq
MIRT2250693	hsa-miR-4722-3p	CLIP-seq
MIRT1075708	hsa-miR-4729	CLIP-seq
MIRT2250694	hsa-miR-4731-3p	CLIP-seq
MIRT2250695	hsa-miR-4763-5p	CLIP-seq
MIRT1075710	hsa-miR-4789-3p	CLIP-seq
MIRT2250696	hsa-miR-4801	CLIP-seq
MIRT2250697	hsa-miR-497	CLIP-seq
MIRT1075712	hsa-miR-526b	CLIP-seq
MIRT2250698	hsa-miR-548k	CLIP-seq
MIRT1075713	hsa-miR-548l	CLIP-seq
MIRT1075714	hsa-miR-548n	CLIP-seq
MIRT2250699	hsa-miR-548t	CLIP-seq
MIRT2250700	hsa-miR-574-5p	CLIP-seq
MIRT2250701	hsa-miR-580	CLIP-seq
MIRT2250684	hsa-miR-3064-3p	CLIP-seq
MIRT2250685	hsa-miR-3163	CLIP-seq
MIRT2554186	hsa-miR-340	CLIP-seq
MIRT2250686	hsa-miR-3682-5p	CLIP-seq
MIRT2554187	hsa-miR-3977	CLIP-seq
MIRT2250688	hsa-miR-4251	CLIP-seq
MIRT2554188	hsa-miR-4252	CLIP-seq
MIRT2250689	hsa-miR-4422	CLIP-seq
MIRT2250692	hsa-miR-4663	CLIP-seq
MIRT2250693	hsa-miR-4722-3p	CLIP-seq
MIRT2250695	hsa-miR-4763-5p	CLIP-seq
MIRT2554189	hsa-miR-4764-3p	CLIP-seq
MIRT2554190	hsa-miR-508-5p	CLIP-seq
MIRT2554191	hsa-miR-516a-3p	CLIP-seq
MIRT2554192	hsa-miR-548an	CLIP-seq
MIRT2250701	hsa-miR-580	CLIP-seq
MIRT2554193	hsa-miR-596	CLIP-seq
MIRT2554194	hsa-miR-766	CLIP-seq
MIRT2250684	hsa-miR-3064-3p	CLIP-seq
MIRT2250685	hsa-miR-3163	CLIP-seq
MIRT2554186	hsa-miR-340	CLIP-seq
MIRT2250686	hsa-miR-3682-5p	CLIP-seq
MIRT2554187	hsa-miR-3977	CLIP-seq
MIRT2250688	hsa-miR-4251	CLIP-seq
MIRT2554188	hsa-miR-4252	CLIP-seq
MIRT2250689	hsa-miR-4422	CLIP-seq
MIRT2250692	hsa-miR-4663	CLIP-seq
MIRT2250693	hsa-miR-4722-3p	CLIP-seq
MIRT2250695	hsa-miR-4763-5p	CLIP-seq
MIRT2554189	hsa-miR-4764-3p	CLIP-seq
MIRT2554190	hsa-miR-508-5p	CLIP-seq
MIRT2554192	hsa-miR-548an	CLIP-seq
MIRT2250701	hsa-miR-580	CLIP-seq
MIRT2554193	hsa-miR-596	CLIP-seq
MIRT2554194	hsa-miR-766	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23825951, 25619834
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005667	Component	Transcription regulator complex	TAS	9696811
GO:0005681	Component	Spliceosomal complex	TAS	9696811
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006383	Process	Transcription by RNA polymerase III	TAS	9696811
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	IMP	23825951
GO:0008380	Process	RNA splicing	TAS	9696811
GO:0009615	Process	Response to virus	IMP	23825951
GO:0009615	Process	Response to virus	TAS	9696811
GO:0031397	Process	Negative regulation of protein ubiquitination	IMP	25619834
GO:0031463	Component	Cul3-RING ubiquitin ligase complex	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IEA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
609209	16951	ENSG00000116679

Q9Y6Y0

Protein name

Influenza virus NS1A-binding protein (NS1-BP) (NS1-binding protein) (Aryl hydrocarbon receptor-associated protein 3) (Kelch-like protein 39)

Protein function

Involved in many cell functions, including pre-mRNA splicing, the aryl hydrocarbon receptor (AHR) pathway, F-actin organization and protein ubiquitination. Plays a role in the dynamic organization of the actin skeleton as a stabilizer of actin f

PDB

5YY8 , 6N34 , 6N3H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00651	BTB	22 → 128	BTB/POZ domain	Domain
PF07707	BACK	134 → 228	BTB And C-terminal Kelch	Domain
PF01344	Kelch_1	357 → 402	Kelch motif	Repeat
PF01344	Kelch_1	404 → 450	Kelch motif	Repeat
PF01344	Kelch_1	452 → 499	Kelch motif	Repeat
PF01344	Kelch_1	501 → 546	Kelch motif	Repeat
PF01344	Kelch_1	548 → 593	Kelch motif	Repeat
PF01344	Kelch_1	595 → 638	Kelch motif	Repeat

Sequence

MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
FNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQV
CGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEV
MLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQ
AEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNATVQSPKHEWKIVASEKTSNN
TYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKPMSPMQYARSG
LGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV
GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLK
NCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWT
LIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAG
IATVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF

Sequence length

642

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency 70	Pathogenic	rs756921311, rs1665467187	RCV001250914 RCV001250915	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
IVNS1ABP-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia	Anemia	BEFREE	29133942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	15383603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	24992002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	31569658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	28264028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	17479159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	17479159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	9159034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	18523634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30277651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	17479159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	7595420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	9348165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11729521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11729521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11729521, 8858117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	17479159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	30940710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	15868901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	20567611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	19208208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22713086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	28198446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30940710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	27035671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29133942, 9444400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	15868901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	19208208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12966589, 15383603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	15919908, 29587786, 31805964		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29871674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waisman syndrome	Waisman syndrome	BEFREE	25934792		★★★★★ ★☆☆☆☆ Found in Text Mining only

IVNS1ABP (influenza virus NS1A binding protein)