Gene Gene information from NCBI Gene database.
Entrez ID 10612
Gene name Tripartite motif containing 3
Gene symbol TRIM3
Synonyms (NCBI Gene)
BERPHAC1RNF22RNF97
Chromosome 11
Chromosome location 11p15.4
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family, also called the `RING-B-box-coiled-coil` (RBCC) subgroup of RING finger proteins. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box ty
miRNA miRNA information provided by mirtarbase database.
258
miRTarBase ID miRNA Experiments Reference
MIRT017768 hsa-miR-335-5p Microarray 18185580
MIRT1453833 hsa-miR-106a CLIP-seq
MIRT1453834 hsa-miR-106b CLIP-seq
MIRT1453835 hsa-miR-130a CLIP-seq
MIRT1453836 hsa-miR-130b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IBA
GO:0002224 Process Toll-like receptor signaling pathway IDA 12471095, 18172197
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0005515 Function Protein binding IPI 19460345, 28514442, 32296183, 33060197, 33961781, 36217029
GO:0005515 Function Protein binding TAS 10391919
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605493 10064 ENSG00000110171
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O75382
Protein name Tripartite motif-containing protein 3 (EC 2.3.2.27) (Brain-expressed RING finger protein) (RING finger protein 22) (RING finger protein 97)
Protein function E3 ubiquitin ligase that plays essential roles in neuronal functions such as regulation of neuronal plasticity, learning, and memory (By similarity). In addition to its neuronal functions, participates in other biological processes such as innat
PDB 7O0B , 7QRW , 8AMR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13445 zf-RING_UBOX 22 60 RING-type zinc-finger Domain
PF00643 zf-B_box 111 151 B-box zinc finger Domain
PF00630 Filamin 319 415 Filamin/ABP280 repeat Domain
PF01436 NHL 486 513 NHL repeat Repeat
PF01436 NHL 533 560 NHL repeat Repeat
PF01436 NHL 575 602 NHL repeat Repeat
PF01436 NHL 622 649 NHL repeat Repeat
PF01436 NHL 669 696 NHL repeat Repeat
PF01436 NHL 713 740 NHL repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, heart, uterus and testis.
Sequence
MAKREDSPGPEVQPMDKQFLVCSICLDRYQCPKVLPCLHTFCERCLQNYIPAQSLTLSCP
VCRQTSILPEQGVSALQNNFFISSLMEAMQQAPDGAHDPEDPHPLSVVAGRPLSCPNHEG
KTMEFYCEACETAMCGECRAGEHREHGTVLL
RDVVEQHKAALQRQLEAVRGRLPQLSAAI
ALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQSQLDT
LRQGQEHIGSSCSFAEQALRLGSAPEVLLVRKHMRERLAALAAQAFPERPHENAQLELVL
EVDGLRRSVLNLGALLTTSATAHETVATGEGLRQALVGQPASLTVTTKDKDGRLVRTGSA
ELRAEITGPDGTRLPVPVVDHKNGTYELVYTARTEGELLLSVLLYGQPVRGSPFR
VRALR
PGDLPPSPDDVKRRVKSPGGPGSHVRQKAVRRPSSMYSTGGKRKDNPIEDELVFRVGSRG
REKGEFTNLQGVSAASSGRIVVADSNNQCIQVFSNEGQFKFRFGVRGRSPGQLQRPTGVA
VDTNGDIIVADYDNRWVSIF
SPEGKFKTKIGAGRLMGPKGVAVDRNGHIIVVDNKSCCVF
TF
QPNGKLVGRFGGRGATDRHFAGPHFVAVNNKNEIVVTDFHNHSVKVYSADGEFLFKFG
SHGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQVFDSSGSFLSYINTSAEPLYGPQGLA
LTSDGHVVVADAGNHCFKAY
RYLQ
Sequence length 744
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon gamma signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISTIC DISORDER Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TRIM3-related disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Arthritis BEFREE 30980385
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 28259936 Inhibit
★☆☆☆☆
Found in Text Mining only
Brain Neoplasms Brain Neoplasms BEFREE 24947043
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 31105849
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 35392925 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 36180926 Inhibit
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 37978273 Inhibit
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 37978273 Inhibit
★☆☆☆☆
Found in Text Mining only
cervical cancer Cervical Cancer BEFREE 29524410, 31270028
★☆☆☆☆
Found in Text Mining only
Cervix carcinoma Cervix carcinoma BEFREE 29524410, 31270028
★☆☆☆☆
Found in Text Mining only