Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10610
Gene name	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
Gene symbol	ST6GALNAC2
Synonyms (NCBI Gene)	SAITL1SIAT7SIAT7BSIATL1ST6GalNAIISTHM
Chromosome	17
Chromosome location	17q25.1
Summary	ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein target

Show/Hide all (69)

miRTarBase ID	miRNA	Experiments
MIRT2118139	hsa-miR-1255a	CLIP-seq
MIRT2118140	hsa-miR-1255b	CLIP-seq
MIRT2118141	hsa-miR-1289	CLIP-seq
MIRT2118142	hsa-miR-136	CLIP-seq
MIRT2118143	hsa-miR-1587	CLIP-seq
MIRT2118144	hsa-miR-3127-5p	CLIP-seq
MIRT2118145	hsa-miR-3135b	CLIP-seq
MIRT2118146	hsa-miR-3140-3p	CLIP-seq
MIRT2118147	hsa-miR-3187-3p	CLIP-seq
MIRT2118148	hsa-miR-3193	CLIP-seq
MIRT2118149	hsa-miR-3198	CLIP-seq
MIRT2118150	hsa-miR-320e	CLIP-seq
MIRT2118151	hsa-miR-337-3p	CLIP-seq
MIRT2118152	hsa-miR-342-5p	CLIP-seq
MIRT2118153	hsa-miR-34b	CLIP-seq
MIRT2118154	hsa-miR-3652	CLIP-seq
MIRT2118155	hsa-miR-3685	CLIP-seq
MIRT2118156	hsa-miR-384	CLIP-seq
MIRT2118157	hsa-miR-3918	CLIP-seq
MIRT2118158	hsa-miR-4254	CLIP-seq
MIRT2118159	hsa-miR-4294	CLIP-seq
MIRT2118160	hsa-miR-4309	CLIP-seq
MIRT2118161	hsa-miR-432	CLIP-seq
MIRT2118162	hsa-miR-4430	CLIP-seq
MIRT2118163	hsa-miR-4435	CLIP-seq
MIRT2118164	hsa-miR-4492	CLIP-seq
MIRT2118165	hsa-miR-4498	CLIP-seq
MIRT2118166	hsa-miR-4651	CLIP-seq
MIRT2118167	hsa-miR-4656	CLIP-seq
MIRT2118168	hsa-miR-4664-5p	CLIP-seq
MIRT2118169	hsa-miR-4674	CLIP-seq
MIRT2118170	hsa-miR-4675	CLIP-seq
MIRT2118171	hsa-miR-4701-5p	CLIP-seq
MIRT2118172	hsa-miR-4731-5p	CLIP-seq
MIRT2118173	hsa-miR-4741	CLIP-seq
MIRT2118174	hsa-miR-4760-5p	CLIP-seq
MIRT2118175	hsa-miR-4772-5p	CLIP-seq
MIRT2118176	hsa-miR-548s	CLIP-seq
MIRT2118177	hsa-miR-561	CLIP-seq
MIRT2118178	hsa-miR-588	CLIP-seq
MIRT2118179	hsa-miR-596	CLIP-seq
MIRT2118180	hsa-miR-608	CLIP-seq
MIRT2118181	hsa-miR-676	CLIP-seq
MIRT2118182	hsa-miR-762	CLIP-seq
MIRT2340185	hsa-miR-1178	CLIP-seq
MIRT2340186	hsa-miR-148a	CLIP-seq
MIRT2340187	hsa-miR-148b	CLIP-seq
MIRT2340188	hsa-miR-152	CLIP-seq
MIRT2340189	hsa-miR-3199	CLIP-seq
MIRT2340190	hsa-miR-338-3p	CLIP-seq
MIRT2340191	hsa-miR-3675-3p	CLIP-seq
MIRT2118155	hsa-miR-3685	CLIP-seq
MIRT2118156	hsa-miR-384	CLIP-seq
MIRT2340192	hsa-miR-4506	CLIP-seq
MIRT2340193	hsa-miR-4530	CLIP-seq
MIRT2118177	hsa-miR-561	CLIP-seq
MIRT2340194	hsa-miR-617	CLIP-seq
MIRT2340195	hsa-miR-628-5p	CLIP-seq
MIRT2340196	hsa-miR-642a	CLIP-seq
MIRT2433612	hsa-miR-149	CLIP-seq
MIRT2433613	hsa-miR-150	CLIP-seq
MIRT2433614	hsa-miR-3064-5p	CLIP-seq
MIRT2433615	hsa-miR-3119	CLIP-seq
MIRT2433616	hsa-miR-3156-3p	CLIP-seq
MIRT2433617	hsa-miR-4301	CLIP-seq
MIRT2433618	hsa-miR-4713-5p	CLIP-seq
MIRT2433619	hsa-miR-4794	CLIP-seq
MIRT2433620	hsa-miR-4795-3p	CLIP-seq
MIRT2433621	hsa-miR-532-3p	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IDA	10742600, 29251719
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IEA
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IDA	29251719
GO:0006486	Process	Protein glycosylation	IEA
GO:0006493	Process	Protein O-linked glycosylation	IBA
GO:0006493	Process	Protein O-linked glycosylation	IDA	10742600
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016266	Process	Protein O-linked glycosylation via N-acetyl-galactosamine	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0019082	Process	Viral protein processing	TAS
GO:1990743	Process	Protein sialylation	IDA	10742600

MIM	HGNC	e!Ensembl
610137	10867	ENSG00000070731

Q9UJ37

Protein name

Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 (EC 2.4.3.3) (GalNAc alpha-2,6-sialyltransferase II) (ST6GalNAc II) (ST6GalNAcII) (SThM) (Sialyltransferase 7B) (SIAT7-B)

Protein function

Catalyzes the transfer of N-acetylneuraminyl groups onto glycan chains in glycoproteins (PubMed:10742600, PubMed:29251719). Conjugates sialic acid with an alpha-2-6 linkage to N-acetylgalactosamine (GalNAc) glycan chains linked to serine or thre

PDB

6APJ , 6APL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	90 → 373	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes. {ECO:0000269|PubMed:10742600}.

Sequence

MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWT
GKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQ
VIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNG
AVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVML
RSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDL
YMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALW
RDLHKAGILQLYQR

Sequence length

374

Interactions

View interactions

	KEGG		Reactome
	Mucin type O-glycan biosynthesis Metabolic pathways		Sialic acid metabolism Termination of O-glycan biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	24520024, 24596201, 24756995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27004849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27004849, 28767179, 29030743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27004849, 33627384, 39348343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	26820593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19170967	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	19357720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	17480010, 19170967, 19357720		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	CTD_human_DG	17480010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28844310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11984005, 24520024, 24596201, 24756995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24596201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11984005		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25756799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	34943806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24520024, 24596201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	26820593		★★★★★ ★☆☆☆☆ Found in Text Mining only

ST6GALNAC2 (ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 2)