Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10605
Gene name	Poly(A) binding protein interacting protein 1
Gene symbol	PAIP1
Synonyms (NCBI Gene)	-
Chromosome	5
Chromosome location	5p12
Summary	The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternat

222

Show/Hide all (222)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028550	hsa-miR-30a-5p	Proteomics	18668040
MIRT050840	hsa-miR-17-5p	CLASH	23622248
MIRT050527	hsa-miR-20a-5p	CLASH	23622248
MIRT036793	hsa-miR-760	CLASH	23622248
MIRT555872	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT555871	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT555870	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT555869	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT555868	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT555867	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT555866	hsa-miR-137	PAR-CLIP	21572407
MIRT555865	hsa-miR-8063	PAR-CLIP	21572407
MIRT555864	hsa-miR-936	PAR-CLIP	21572407
MIRT555863	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT555862	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT555861	hsa-miR-5047	PAR-CLIP	21572407
MIRT450213	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT450212	hsa-miR-6835-3p	PAR-CLIP	22100165
MIRT450211	hsa-miR-4422	PAR-CLIP	22100165
MIRT450210	hsa-miR-1245b-3p	PAR-CLIP	22100165
MIRT450209	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT555872	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT555871	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT555870	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT555869	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT555868	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT555867	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT555866	hsa-miR-137	PAR-CLIP	21572407
MIRT555865	hsa-miR-8063	PAR-CLIP	21572407
MIRT555864	hsa-miR-936	PAR-CLIP	21572407
MIRT555863	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT555862	hsa-miR-1301-3p	PAR-CLIP	21572407
MIRT555861	hsa-miR-5047	PAR-CLIP	21572407
MIRT450213	hsa-miR-5582-3p	PAR-CLIP	22100165
MIRT450212	hsa-miR-6835-3p	PAR-CLIP	22100165
MIRT450211	hsa-miR-4422	PAR-CLIP	22100165
MIRT450210	hsa-miR-1245b-3p	PAR-CLIP	22100165
MIRT450209	hsa-miR-570-3p	PAR-CLIP	22100165
MIRT1210957	hsa-miR-3609	CLIP-seq
MIRT1210958	hsa-miR-539	CLIP-seq
MIRT1210959	hsa-miR-548ah	CLIP-seq
MIRT1210960	hsa-miR-548n	CLIP-seq
MIRT1210961	hsa-miR-548t	CLIP-seq
MIRT1210962	hsa-miR-1251	CLIP-seq
MIRT1210963	hsa-miR-1273d	CLIP-seq
MIRT1210964	hsa-miR-1283	CLIP-seq
MIRT1210965	hsa-miR-1301	CLIP-seq
MIRT1210966	hsa-miR-1302	CLIP-seq
MIRT1210967	hsa-miR-197	CLIP-seq
MIRT1210968	hsa-miR-221	CLIP-seq
MIRT1210969	hsa-miR-222	CLIP-seq
MIRT1210970	hsa-miR-25	CLIP-seq
MIRT1210971	hsa-miR-3117-5p	CLIP-seq
MIRT1210972	hsa-miR-3122	CLIP-seq
MIRT1210973	hsa-miR-3192	CLIP-seq
MIRT1210974	hsa-miR-32	CLIP-seq
MIRT1210975	hsa-miR-325	CLIP-seq
MIRT1210976	hsa-miR-363	CLIP-seq
MIRT1210977	hsa-miR-367	CLIP-seq
MIRT1210978	hsa-miR-3913-5p	CLIP-seq
MIRT1210979	hsa-miR-4298	CLIP-seq
MIRT1210980	hsa-miR-4684-5p	CLIP-seq
MIRT1210981	hsa-miR-548v	CLIP-seq
MIRT1210982	hsa-miR-628-3p	CLIP-seq
MIRT1210983	hsa-miR-92a	CLIP-seq
MIRT1210984	hsa-miR-92b	CLIP-seq
MIRT1210985	hsa-miR-1263	CLIP-seq
MIRT1210986	hsa-miR-1271	CLIP-seq
MIRT1210987	hsa-miR-140-3p	CLIP-seq
MIRT1210988	hsa-miR-182	CLIP-seq
MIRT1210989	hsa-miR-3185	CLIP-seq
MIRT1210990	hsa-miR-3679-3p	CLIP-seq
MIRT1210991	hsa-miR-4255	CLIP-seq
MIRT1210992	hsa-miR-4446-3p	CLIP-seq
MIRT1210993	hsa-miR-4446-5p	CLIP-seq
MIRT1210994	hsa-miR-4528	CLIP-seq
MIRT1210995	hsa-miR-4656	CLIP-seq
MIRT1210996	hsa-miR-96	CLIP-seq
MIRT1210986	hsa-miR-1271	CLIP-seq
MIRT1210988	hsa-miR-182	CLIP-seq
MIRT2060532	hsa-miR-4775	CLIP-seq
MIRT2060533	hsa-miR-561	CLIP-seq
MIRT1210996	hsa-miR-96	CLIP-seq
MIRT1210986	hsa-miR-1271	CLIP-seq
MIRT1210963	hsa-miR-1273d	CLIP-seq
MIRT1210964	hsa-miR-1283	CLIP-seq
MIRT1210965	hsa-miR-1301	CLIP-seq
MIRT2289207	hsa-miR-1305	CLIP-seq
MIRT1210988	hsa-miR-182	CLIP-seq
MIRT1210968	hsa-miR-221	CLIP-seq
MIRT1210969	hsa-miR-222	CLIP-seq
MIRT1210970	hsa-miR-25	CLIP-seq
MIRT2289208	hsa-miR-3163	CLIP-seq
MIRT2289209	hsa-miR-3166	CLIP-seq
MIRT2289210	hsa-miR-3180-5p	CLIP-seq
MIRT1210989	hsa-miR-3185	CLIP-seq
MIRT1210974	hsa-miR-32	CLIP-seq
MIRT1210975	hsa-miR-325	CLIP-seq
MIRT2289211	hsa-miR-340	CLIP-seq
MIRT2289212	hsa-miR-3591-5p	CLIP-seq
MIRT1210957	hsa-miR-3609	CLIP-seq
MIRT1210976	hsa-miR-363	CLIP-seq
MIRT1210977	hsa-miR-367	CLIP-seq
MIRT1210990	hsa-miR-3679-3p	CLIP-seq
MIRT2289213	hsa-miR-3924	CLIP-seq
MIRT1210991	hsa-miR-4255	CLIP-seq
MIRT2289214	hsa-miR-4328	CLIP-seq
MIRT1210993	hsa-miR-4446-5p	CLIP-seq
MIRT2289215	hsa-miR-4473	CLIP-seq
MIRT2289216	hsa-miR-4477a	CLIP-seq
MIRT2289217	hsa-miR-448	CLIP-seq
MIRT2289218	hsa-miR-4495	CLIP-seq
MIRT2289219	hsa-miR-4504	CLIP-seq
MIRT2289220	hsa-miR-4517	CLIP-seq
MIRT2289221	hsa-miR-4524	CLIP-seq
MIRT2289222	hsa-miR-4666-5p	CLIP-seq
MIRT2289223	hsa-miR-4671-3p	CLIP-seq
MIRT2289224	hsa-miR-4672	CLIP-seq
MIRT2289225	hsa-miR-4699-3p	CLIP-seq
MIRT2289226	hsa-miR-4742-3p	CLIP-seq
MIRT2289227	hsa-miR-4744	CLIP-seq
MIRT2289228	hsa-miR-4803	CLIP-seq
MIRT2289229	hsa-miR-498	CLIP-seq
MIRT2289230	hsa-miR-500a	CLIP-seq
MIRT2289231	hsa-miR-501-5p	CLIP-seq
MIRT2289232	hsa-miR-512-3p	CLIP-seq
MIRT2289233	hsa-miR-520a-5p	CLIP-seq
MIRT2289234	hsa-miR-520f	CLIP-seq
MIRT2289235	hsa-miR-525-5p	CLIP-seq
MIRT1210958	hsa-miR-539	CLIP-seq
MIRT2289236	hsa-miR-542-3p	CLIP-seq
MIRT2289237	hsa-miR-548a-3p	CLIP-seq
MIRT1210959	hsa-miR-548ah	CLIP-seq
MIRT2289238	hsa-miR-548e	CLIP-seq
MIRT2289239	hsa-miR-548f	CLIP-seq
MIRT2289240	hsa-miR-548g	CLIP-seq
MIRT1210960	hsa-miR-548n	CLIP-seq
MIRT1210961	hsa-miR-548t	CLIP-seq
MIRT1210981	hsa-miR-548v	CLIP-seq
MIRT2060533	hsa-miR-561	CLIP-seq
MIRT2289241	hsa-miR-578	CLIP-seq
MIRT2289242	hsa-miR-581	CLIP-seq
MIRT1210982	hsa-miR-628-3p	CLIP-seq
MIRT2289243	hsa-miR-802	CLIP-seq
MIRT1210983	hsa-miR-92a	CLIP-seq
MIRT1210984	hsa-miR-92b	CLIP-seq
MIRT1210996	hsa-miR-96	CLIP-seq
MIRT1210962	hsa-miR-1251	CLIP-seq
MIRT1210985	hsa-miR-1263	CLIP-seq
MIRT1210963	hsa-miR-1273d	CLIP-seq
MIRT1210964	hsa-miR-1283	CLIP-seq
MIRT2586962	hsa-miR-1296	CLIP-seq
MIRT1210987	hsa-miR-140-3p	CLIP-seq
MIRT2586963	hsa-miR-190	CLIP-seq
MIRT2586964	hsa-miR-190b	CLIP-seq
MIRT1210968	hsa-miR-221	CLIP-seq
MIRT1210969	hsa-miR-222	CLIP-seq
MIRT2586965	hsa-miR-2909	CLIP-seq
MIRT2586966	hsa-miR-3158-3p	CLIP-seq
MIRT2289208	hsa-miR-3163	CLIP-seq
MIRT1210975	hsa-miR-325	CLIP-seq
MIRT2586967	hsa-miR-331-5p	CLIP-seq
MIRT2289211	hsa-miR-340	CLIP-seq
MIRT1210957	hsa-miR-3609	CLIP-seq
MIRT2586968	hsa-miR-4282	CLIP-seq
MIRT1210992	hsa-miR-4446-3p	CLIP-seq
MIRT2289219	hsa-miR-4504	CLIP-seq
MIRT1210995	hsa-miR-4656	CLIP-seq
MIRT1210980	hsa-miR-4684-5p	CLIP-seq
MIRT2586969	hsa-miR-4728-3p	CLIP-seq
MIRT2586970	hsa-miR-4795-3p	CLIP-seq
MIRT1210958	hsa-miR-539	CLIP-seq
MIRT2289236	hsa-miR-542-3p	CLIP-seq
MIRT2289237	hsa-miR-548a-3p	CLIP-seq
MIRT1210959	hsa-miR-548ah	CLIP-seq
MIRT2586971	hsa-miR-548c-3p	CLIP-seq
MIRT2289238	hsa-miR-548e	CLIP-seq
MIRT2289239	hsa-miR-548f	CLIP-seq
MIRT2289240	hsa-miR-548g	CLIP-seq
MIRT1210960	hsa-miR-548n	CLIP-seq
MIRT1210961	hsa-miR-548t	CLIP-seq
MIRT1210981	hsa-miR-548v	CLIP-seq
MIRT2289241	hsa-miR-578	CLIP-seq
MIRT2289242	hsa-miR-581	CLIP-seq
MIRT1210982	hsa-miR-628-3p	CLIP-seq
MIRT2586972	hsa-miR-656	CLIP-seq
MIRT1210962	hsa-miR-1251	CLIP-seq
MIRT1210985	hsa-miR-1263	CLIP-seq
MIRT1210963	hsa-miR-1273d	CLIP-seq
MIRT1210964	hsa-miR-1283	CLIP-seq
MIRT2586962	hsa-miR-1296	CLIP-seq
MIRT1210987	hsa-miR-140-3p	CLIP-seq
MIRT2586963	hsa-miR-190	CLIP-seq
MIRT2586964	hsa-miR-190b	CLIP-seq
MIRT1210968	hsa-miR-221	CLIP-seq
MIRT1210969	hsa-miR-222	CLIP-seq
MIRT2586965	hsa-miR-2909	CLIP-seq
MIRT2586966	hsa-miR-3158-3p	CLIP-seq
MIRT2289208	hsa-miR-3163	CLIP-seq
MIRT1210975	hsa-miR-325	CLIP-seq
MIRT2586967	hsa-miR-331-5p	CLIP-seq
MIRT2289211	hsa-miR-340	CLIP-seq
MIRT2586968	hsa-miR-4282	CLIP-seq
MIRT1210992	hsa-miR-4446-3p	CLIP-seq
MIRT2289219	hsa-miR-4504	CLIP-seq
MIRT1210995	hsa-miR-4656	CLIP-seq
MIRT1210980	hsa-miR-4684-5p	CLIP-seq
MIRT2586969	hsa-miR-4728-3p	CLIP-seq
MIRT2586970	hsa-miR-4795-3p	CLIP-seq
MIRT2289236	hsa-miR-542-3p	CLIP-seq
MIRT2289237	hsa-miR-548a-3p	CLIP-seq
MIRT2586971	hsa-miR-548c-3p	CLIP-seq
MIRT2289238	hsa-miR-548e	CLIP-seq
MIRT2289239	hsa-miR-548f	CLIP-seq
MIRT2289240	hsa-miR-548g	CLIP-seq
MIRT1210960	hsa-miR-548n	CLIP-seq
MIRT1210961	hsa-miR-548t	CLIP-seq
MIRT1210981	hsa-miR-548v	CLIP-seq
MIRT2289241	hsa-miR-578	CLIP-seq
MIRT2289242	hsa-miR-581	CLIP-seq
MIRT1210982	hsa-miR-628-3p	CLIP-seq
MIRT2586972	hsa-miR-656	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	9548260
GO:0005515	Function	Protein binding	IPI	9548260, 10970864, 11051545, 11997512, 14685257, 24396066, 32296183, 33876849, 33961781, 35271311, 37100772
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9548260
GO:0005829	Component	Cytosol	IDA	11051545
GO:0005829	Component	Cytosol	TAS
GO:0006413	Process	Translational initiation	TAS	9548260
GO:0006417	Process	Regulation of translation	IEA
GO:0006446	Process	Regulation of translational initiation	IBA
GO:0008494	Function	Translation activator activity	IBA
GO:0008494	Function	Translation activator activity	IDA	9548260
GO:0044794	Process	Host-mediated activation of viral process	IDA	33876849
GO:0048255	Process	MRNA stabilization	TAS	11997512
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	11051545
GO:0106002	Component	MCRD-mediated mRNA stability complex	IPI	11051545
GO:1900152	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	11051545
GO:2000767	Process	Positive regulation of cytoplasmic translation	IDA	11051545

MIM	HGNC	e!Ensembl
605184	16945	ENSG00000172239

Q9H074

Protein name

Polyadenylate-binding protein-interacting protein 1 (PABP-interacting protein 1) (PAIP-1) (Poly(A)-binding protein-interacting protein 1)

Protein function

Acts as a coactivator in the regulation of translation initiation of poly(A)-containing mRNAs. Its stimulatory activity on translation is mediated via its action on PABPC1. Competes with PAIP2 for binding to PABPC1. Its association with EIF4A an

PDB

1JH4 , 3NTW , 3RK6 , 6YXJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07145	PAM2	123 → 140	Ataxin-2 C-terminal region	Motif
PF02854	MIF4G	159 → 376	MIF4G domain	Family

Sequence

MSDGFDRAPGAGRGRSRGLGRGGGGPEGGGFPNGAGPAERARHQPPQPKAPGFLQPPPLR
QPRTTPPPGAQCEVPASPQRPSRPGALPEQTRPLRAPPSSQDKIPQQNSESAMAKPQVVV
APVLMSKLSVNAPEFYPSGYSSSYTESYEDGCEDYPTLSEYVQDFLNHLTEQPGSFETEI
EQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQ
LLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGL
RELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSR
DVKQMLLKLVELRSSNWGRVHATSTYREATPENDPNYFMNEPTFYTSDGVPFTAADPDYQ
EKYQELLEREDFFPDYEENGTDLSGAGDPYLDDIDDEMDPEIEEAYEKFCLESERKRKQ

Sequence length

479

Interactions

View interactions

	Reactome
			Deadenylation of mRNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30496797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32871777, 37101794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	37101794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35153296	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29258905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31496746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38286121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27454520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35153296	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31496746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18559093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PAIP1 (poly(A) binding protein interacting protein 1)