Gene Gene information from NCBI Gene database.
Entrez ID 10589
Gene name DR1 associated protein 1
Gene symbol DRAP1
Synonyms (NCBI Gene)
NC2-alpha
Chromosome 11
Chromosome location 11q13.1
Summary Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprote
miRNA miRNA information provided by mirtarbase database.
3
miRTarBase ID miRNA Experiments Reference
MIRT020517 hsa-miR-155-5p Proteomics 18668040
MIRT023515 hsa-miR-1-3p Proteomics 18668040
MIRT038135 hsa-miR-423-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 8670811
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 8608938
GO:0001046 Function Core promoter sequence-specific DNA binding IBA
GO:0001091 Function RNA polymerase II general transcription initiation factor binding IDA 8608938
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602289 3019 ENSG00000175550
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14919
Protein name Dr1-associated corepressor (Dr1-associated protein 1) (Negative cofactor 2-alpha) (NC2-alpha)
Protein function The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the
PDB 1JFI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00808 CBFD_NFYB_HMF 10 74 Histone-like transcription factor (CBF/NF-Y) and archaeal histone Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highly expressed in adult testis, heart, skeletal muscle, pancreas and brain, and in fetal brain, liver and kidney. {ECO:0000269|PubMed:8608938, ECO:0000269|PubMed:8670811}.
Sequence
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCI
ELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRK
NGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFA
STLPLPPAPPGPSAPDEEDEEDYDS
Sequence length 205
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Signaling by NODAL
Signaling by Activin
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
6
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MELANOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 34493366 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 35812454 Associate
★☆☆☆☆
Found in Text Mining only
Hemangiosarcoma Hemangiosarcoma BEFREE 28588707
★☆☆☆☆
Found in Text Mining only
Hypoxia Hypoxia Pubtator 12477712 Stimulate
★☆☆☆☆
Found in Text Mining only
melanoma Melanoma CTD_human_DG 22535842
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive Chronic obstructive pulmonary disease Pubtator 34588774 Associate
★☆☆☆☆
Found in Text Mining only
Sveinsson Chorioretinal Atrophy Sveinsson chorioretinal atrophy Pubtator 34493366 Stimulate
★☆☆☆☆
Found in Text Mining only