Gene Gene information from NCBI Gene database.
Entrez ID 10581
Gene name Interferon induced transmembrane protein 2
Gene symbol IFITM2
Synonyms (NCBI Gene)
1-8DDSPA2c
Chromosome 11
Chromosome location 11p15.5
miRNA miRNA information provided by mirtarbase database.
195
miRTarBase ID miRNA Experiments Reference
MIRT1060544 hsa-miR-1185 CLIP-seq
MIRT1060545 hsa-miR-1207-5p CLIP-seq
MIRT1060546 hsa-miR-1286 CLIP-seq
MIRT1060547 hsa-miR-1294 CLIP-seq
MIRT1060548 hsa-miR-1322 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane IDA 26354436
GO:0005765 Component Lysosomal membrane IEA
GO:0005768 Component Endosome IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605578 5413 ENSG00000185201
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q01629
Protein name Interferon-induced transmembrane protein 2 (Dispanin subfamily A member 2c) (DSPA2c) (Interferon-inducible protein 1-8D)
Protein function IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol (PubMed:26354436, PubMed:33563656). Activ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04505 CD225 53 120 Interferon-induced transmembrane protein Family
Sequence
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWS
LFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILL

IIIPVLVVQAQR
Sequence length 132
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon alpha/beta signaling
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTOIMMUNE THYROID DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 15099960
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 34108016 Associate
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 18071348, 19544527
★☆☆☆☆
Found in Text Mining only
Dermatitis, Atopic Dermatitis BEFREE 22445417
★☆☆☆☆
Found in Text Mining only
Eczema Eczema BEFREE 22445417
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory bowel disease Pubtator 18776587 Associate
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 33308825 Stimulate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 28223169
★☆☆☆☆
Found in Text Mining only
Multiple Myeloma Multiple myeloma Pubtator 36131282 Associate
★☆☆☆☆
Found in Text Mining only
Multiple Sclerosis Multiple sclerosis Pubtator 38038362 Associate
★☆☆☆☆
Found in Text Mining only