Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1058
Gene name	Centromere protein A
Gene symbol	CENPA
Synonyms (NCBI Gene)	CENP-ACenH3
Chromosome	2
Chromosome location	2p23.3
Summary	Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centr

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024281	hsa-miR-215-5p	Microarray	19074876
MIRT026545	hsa-miR-192-5p	Microarray	19074876
MIRT509494	hsa-miR-411-5p	PAR-CLIP	21572407
MIRT509493	hsa-miR-187-3p	PAR-CLIP	21572407
MIRT529763	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT529762	hsa-miR-6750-3p	PAR-CLIP	22012620
MIRT529761	hsa-miR-6813-3p	PAR-CLIP	22012620
MIRT529760	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT529759	hsa-miR-4719	PAR-CLIP	22012620
MIRT529758	hsa-miR-432-5p	PAR-CLIP	22012620
MIRT529757	hsa-miR-1289	PAR-CLIP	22012620
MIRT529756	hsa-miR-4294	PAR-CLIP	22012620
MIRT529755	hsa-miR-3198	PAR-CLIP	22012620
MIRT529754	hsa-miR-4309	PAR-CLIP	22012620
MIRT243088	hsa-miR-1276	PAR-CLIP	22012620
MIRT243089	hsa-miR-5692a	PAR-CLIP	22012620
MIRT529753	hsa-miR-376c-3p	PAR-CLIP	22012620
MIRT529752	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT243087	hsa-miR-610	PAR-CLIP	22012620
MIRT509494	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT509493	hsa-miR-187-3p	PAR-CLIP	23446348
MIRT509492	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT509494	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT509493	hsa-miR-187-3p	PAR-CLIP	23446348
MIRT509492	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT509491	hsa-miR-3153	PAR-CLIP	23446348
MIRT509490	hsa-miR-6733-5p	PAR-CLIP	23446348
MIRT509489	hsa-miR-6739-5p	PAR-CLIP	23446348
MIRT509494	hsa-miR-411-5p	PAR-CLIP	21572407
MIRT509493	hsa-miR-187-3p	PAR-CLIP	21572407
MIRT529763	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT529762	hsa-miR-6750-3p	PAR-CLIP	22012620
MIRT529761	hsa-miR-6813-3p	PAR-CLIP	22012620
MIRT529760	hsa-miR-4714-3p	PAR-CLIP	22012620
MIRT529759	hsa-miR-4719	PAR-CLIP	22012620
MIRT529758	hsa-miR-432-5p	PAR-CLIP	22012620
MIRT529757	hsa-miR-1289	PAR-CLIP	22012620
MIRT529756	hsa-miR-4294	PAR-CLIP	22012620
MIRT529755	hsa-miR-3198	PAR-CLIP	22012620
MIRT529754	hsa-miR-4309	PAR-CLIP	22012620
MIRT243088	hsa-miR-1276	PAR-CLIP	22012620
MIRT243089	hsa-miR-5692a	PAR-CLIP	22012620
MIRT529753	hsa-miR-376c-3p	PAR-CLIP	22012620
MIRT529752	hsa-miR-6504-3p	PAR-CLIP	22012620
MIRT243087	hsa-miR-610	PAR-CLIP	22012620
MIRT509494	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT509493	hsa-miR-187-3p	PAR-CLIP	23446348
MIRT509492	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT509494	hsa-miR-411-5p	PAR-CLIP	23446348
MIRT509493	hsa-miR-187-3p	PAR-CLIP	23446348
MIRT509492	hsa-miR-4668-5p	PAR-CLIP	23446348
MIRT509491	hsa-miR-3153	PAR-CLIP	23446348
MIRT509490	hsa-miR-6733-5p	PAR-CLIP	23446348
MIRT509489	hsa-miR-6739-5p	PAR-CLIP	23446348
MIRT884618	hsa-miR-1272	CLIP-seq
MIRT884619	hsa-miR-1322	CLIP-seq
MIRT884620	hsa-miR-219-5p	CLIP-seq
MIRT884621	hsa-miR-2467-3p	CLIP-seq
MIRT884622	hsa-miR-3125	CLIP-seq
MIRT884623	hsa-miR-3134	CLIP-seq
MIRT884624	hsa-miR-3545-5p	CLIP-seq
MIRT884625	hsa-miR-3614-3p	CLIP-seq
MIRT884626	hsa-miR-365	CLIP-seq
MIRT884627	hsa-miR-3688-3p	CLIP-seq
MIRT884628	hsa-miR-3916	CLIP-seq
MIRT884629	hsa-miR-3973	CLIP-seq
MIRT884630	hsa-miR-4257	CLIP-seq
MIRT884631	hsa-miR-4279	CLIP-seq
MIRT884632	hsa-miR-4297	CLIP-seq
MIRT884633	hsa-miR-4445	CLIP-seq
MIRT884634	hsa-miR-4534	CLIP-seq
MIRT884635	hsa-miR-4645-5p	CLIP-seq
MIRT884636	hsa-miR-4673	CLIP-seq
MIRT884637	hsa-miR-4742-5p	CLIP-seq
MIRT884638	hsa-miR-4777-3p	CLIP-seq
MIRT884639	hsa-miR-4782-3p	CLIP-seq
MIRT884640	hsa-miR-4796-3p	CLIP-seq
MIRT884641	hsa-miR-4796-5p	CLIP-seq
MIRT884642	hsa-miR-4797-5p	CLIP-seq
MIRT884643	hsa-miR-508-3p	CLIP-seq
MIRT884644	hsa-miR-520g	CLIP-seq
MIRT884645	hsa-miR-520h	CLIP-seq
MIRT884646	hsa-miR-556-3p	CLIP-seq
MIRT884647	hsa-miR-656	CLIP-seq
MIRT884648	hsa-miR-767-3p	CLIP-seq
MIRT884649	hsa-miR-942	CLIP-seq
MIRT884650	hsa-miR-4717-3p	CLIP-seq
MIRT884618	hsa-miR-1272	CLIP-seq
MIRT1962347	hsa-miR-1305	CLIP-seq
MIRT884619	hsa-miR-1322	CLIP-seq
MIRT1962348	hsa-miR-1324	CLIP-seq
MIRT1962349	hsa-miR-198	CLIP-seq
MIRT884621	hsa-miR-2467-3p	CLIP-seq
MIRT1962350	hsa-miR-2467-5p	CLIP-seq
MIRT1962351	hsa-miR-3120-3p	CLIP-seq
MIRT884623	hsa-miR-3134	CLIP-seq
MIRT1962352	hsa-miR-3179	CLIP-seq
MIRT1962353	hsa-miR-3188	CLIP-seq
MIRT884624	hsa-miR-3545-5p	CLIP-seq
MIRT884625	hsa-miR-3614-3p	CLIP-seq
MIRT884626	hsa-miR-365	CLIP-seq
MIRT1962354	hsa-miR-3664-5p	CLIP-seq
MIRT1962355	hsa-miR-3671	CLIP-seq
MIRT884627	hsa-miR-3688-3p	CLIP-seq
MIRT1962356	hsa-miR-3919	CLIP-seq
MIRT884629	hsa-miR-3973	CLIP-seq
MIRT1962357	hsa-miR-3975	CLIP-seq
MIRT1962358	hsa-miR-4252	CLIP-seq
MIRT884630	hsa-miR-4257	CLIP-seq
MIRT884632	hsa-miR-4297	CLIP-seq
MIRT1962359	hsa-miR-4307	CLIP-seq
MIRT1962360	hsa-miR-4316	CLIP-seq
MIRT1962361	hsa-miR-4436b-3p	CLIP-seq
MIRT884634	hsa-miR-4534	CLIP-seq
MIRT884635	hsa-miR-4645-5p	CLIP-seq
MIRT1962362	hsa-miR-4668-3p	CLIP-seq
MIRT884636	hsa-miR-4673	CLIP-seq
MIRT1962363	hsa-miR-4698	CLIP-seq
MIRT1962364	hsa-miR-4710	CLIP-seq
MIRT1962365	hsa-miR-4714-5p	CLIP-seq
MIRT884637	hsa-miR-4742-5p	CLIP-seq
MIRT1962366	hsa-miR-4756-3p	CLIP-seq
MIRT1962367	hsa-miR-4792	CLIP-seq
MIRT884640	hsa-miR-4796-3p	CLIP-seq
MIRT884641	hsa-miR-4796-5p	CLIP-seq
MIRT1962368	hsa-miR-485-5p	CLIP-seq
MIRT884644	hsa-miR-520g	CLIP-seq
MIRT884645	hsa-miR-520h	CLIP-seq
MIRT1962369	hsa-miR-545	CLIP-seq
MIRT1962370	hsa-miR-607	CLIP-seq
MIRT884648	hsa-miR-767-3p	CLIP-seq
MIRT2198769	hsa-miR-3064-5p	CLIP-seq
MIRT884626	hsa-miR-365	CLIP-seq
MIRT2198770	hsa-miR-4468	CLIP-seq
MIRT2198771	hsa-miR-4663	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000132	Process	Establishment of mitotic spindle orientation	IMP	19468067
GO:0000281	Process	Mitotic cytokinesis	IMP	27499292
GO:0000775	Component	Chromosome, centromeric region	IDA	11084331, 27499292
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0000775	Component	Chromosome, centromeric region	TAS	7962047
GO:0000779	Component	Condensed chromosome, centromeric region	IDA	11682612
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000786	Component	Nucleosome	IDA	27499292
GO:0000786	Component	Nucleosome	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	TAS	7962047
GO:0005515	Function	Protein binding	IPI	19410544, 19410545, 19503796, 19533040, 20080577, 20739937, 21478274, 26167883, 26496610, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	27499292
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7962047
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005721	Component	Pericentric heterochromatin	IEA
GO:0005829	Component	Cytosol	TAS
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0034080	Process	CENP-A containing chromatin assembly	IDA	11682612
GO:0043505	Component	CENP-A containing nucleosome	IDA	18195732
GO:0043505	Component	CENP-A containing nucleosome	IPI	21743476
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0051301	Process	Cell division	IEA
GO:0051382	Process	Kinetochore assembly	IDA	11682612
GO:0061638	Component	CENP-A containing chromatin	IEA
GO:0061644	Process	Protein localization to CENP-A containing chromatin	NAS	21743476
GO:0071459	Process	Protein localization to chromosome, centromeric region	IDA	11682612
GO:0071459	Process	Protein localization to chromosome, centromeric region	IEA
GO:0071459	Process	Protein localization to chromosome, centromeric region	IEA

MIM	HGNC	e!Ensembl
117139	1851	ENSG00000115163

P49450

Protein name

Histone H3-like centromeric protein A (Centromere autoantigen A) (Centromere protein A) (CENP-A)

Protein function

Histone H3-like nucleosomal protein that is specifically found in centromeric nucleosomes (PubMed:11756469, PubMed:14667408, PubMed:15282608, PubMed:15475964, PubMed:15702419, PubMed:17651496, PubMed:19114591, PubMed:20739937, PubMed:27499292, P

PDB

3AN2 , 3NQJ , 3NQU , 3R45 , 3WTP , 5CVD , 5Z23 , 6BUZ , 6C0W , 6E0C , 6E0P , 6KDQ , 6KDS , 6L49 , 6MUO , 6MUP , 6O1D , 6SE0 , 6SE6 , 6SEE , 6SEF , 6SEG , 6TEM , 7D20 , 7PII , 7R5R , 7U46 , 7U47 , 7U4D , 7YWX , 7YYH , 9GXA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	2 → 133	Core histone H2A/H2B/H3/H4	Domain

Sequence

MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHL
LIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAGRVT
LFPKDVQLARRIRGLEEGLG

Sequence length

140

Interactions

View interactions

	Reactome
			Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion RHO GTPases Activate Formins Deposition of new CENPA-containing nucleosomes at the centromere Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22369099, 22542705, 25228009, 29608985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	20003272, 36292582, 37075754, 37779031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24676531, 27062469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22559056, 29642861, 32925947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28760857, 28980868	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	17970049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30247807, 31790363, 32337237, 34556750, 37059592, 37181805, 37928273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	23712606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	39456925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32090070, 34627268, 36163007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23712606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	28596481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	28596481, 28760857, 28980868, 38038247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12839935, 15930286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12839935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28486948, 30658502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28286049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28286049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28286049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23712606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35496042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32467990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	36292582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	10759786	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29971007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	36581379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21423629, 31790363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35816352	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36581379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24676531, 27062469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31031850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21484447, 25228009, 25408271, 27062469, 28760857, 28980868, 30590707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28137567, 28356341, 28760857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	22559056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	33153400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35934260	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36401386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31031850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32371391, 36891298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37488766	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Raynaud Disease	Raynaud disease	Pubtator	3048807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	37243594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	17210244, 23580138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	31871193, 36581379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	17970049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	17970049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	33986742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36012427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34617858	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17210244, 23580138, 28240591, 29369808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24676531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35685866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CENPA (centromere protein A)