Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10576
Gene name	Chaperonin containing TCP1 subunit 2
Gene symbol	CCT2
Synonyms (NCBI Gene)	99D8.1CCT-betaCCTBHEL-S-100nPRO1633TCP-1-beta
Chromosome	12
Chromosome location	12q15
Summary	The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different p

136

Show/Hide all (136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021019	hsa-miR-155-5p	Proteomics	18668040
MIRT041339	hsa-miR-193b-3p	CLASH	23622248
MIRT066727	hsa-miR-3646	PAR-CLIP	20371350
MIRT459841	hsa-miR-5700	PAR-CLIP	20371350
MIRT066720	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT066729	hsa-miR-5680	PAR-CLIP	20371350
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT066722	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT021019	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT066727	hsa-miR-3646	PAR-CLIP	20371350
MIRT459841	hsa-miR-5700	PAR-CLIP	20371350
MIRT066720	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT066729	hsa-miR-5680	PAR-CLIP	20371350
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT066722	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT021019	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT066728	hsa-miR-3671	PAR-CLIP	20371350
MIRT066724	hsa-miR-607	PAR-CLIP	20371350
MIRT066727	hsa-miR-3646	PAR-CLIP	20371350
MIRT459841	hsa-miR-5700	PAR-CLIP	20371350
MIRT066720	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT066729	hsa-miR-5680	PAR-CLIP	20371350
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT066722	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT021019	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT066727	hsa-miR-3646	PAR-CLIP	23446348
MIRT459841	hsa-miR-5700	PAR-CLIP	23446348
MIRT066720	hsa-miR-144-3p	PAR-CLIP	23446348
MIRT066729	hsa-miR-5680	PAR-CLIP	23446348
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	23446348
MIRT066722	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT021019	hsa-miR-155-5p	PAR-CLIP	23446348
MIRT066727	hsa-miR-3646	PAR-CLIP	23592263
MIRT459841	hsa-miR-5700	PAR-CLIP	23592263
MIRT066720	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT066729	hsa-miR-5680	PAR-CLIP	23592263
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT066722	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT021019	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT066728	hsa-miR-3671	PAR-CLIP	23592263
MIRT066724	hsa-miR-607	PAR-CLIP	23592263
MIRT066727	hsa-miR-3646	PAR-CLIP	20371350
MIRT459841	hsa-miR-5700	PAR-CLIP	20371350
MIRT066720	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT066729	hsa-miR-5680	PAR-CLIP	20371350
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT066722	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT021019	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT066727	hsa-miR-3646	PAR-CLIP	20371350
MIRT459841	hsa-miR-5700	PAR-CLIP	20371350
MIRT066720	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT066729	hsa-miR-5680	PAR-CLIP	20371350
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT066722	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT021019	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT066728	hsa-miR-3671	PAR-CLIP	20371350
MIRT066724	hsa-miR-607	PAR-CLIP	20371350
MIRT066727	hsa-miR-3646	PAR-CLIP	20371350
MIRT459841	hsa-miR-5700	PAR-CLIP	20371350
MIRT066720	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT066729	hsa-miR-5680	PAR-CLIP	20371350
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	20371350
MIRT066722	hsa-miR-539-5p	PAR-CLIP	20371350
MIRT021019	hsa-miR-155-5p	PAR-CLIP	20371350
MIRT066727	hsa-miR-3646	PAR-CLIP	23446348
MIRT459841	hsa-miR-5700	PAR-CLIP	23446348
MIRT066720	hsa-miR-144-3p	PAR-CLIP	23446348
MIRT066729	hsa-miR-5680	PAR-CLIP	23446348
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	23446348
MIRT066722	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT021019	hsa-miR-155-5p	PAR-CLIP	23446348
MIRT066727	hsa-miR-3646	PAR-CLIP	23592263
MIRT459841	hsa-miR-5700	PAR-CLIP	23592263
MIRT066720	hsa-miR-144-3p	PAR-CLIP	23592263
MIRT066729	hsa-miR-5680	PAR-CLIP	23592263
MIRT459840	hsa-miR-4712-3p	PAR-CLIP	23592263
MIRT066722	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT021019	hsa-miR-155-5p	PAR-CLIP	23592263
MIRT066728	hsa-miR-3671	PAR-CLIP	23592263
MIRT066724	hsa-miR-607	PAR-CLIP	23592263
MIRT873339	hsa-miR-144	CLIP-seq
MIRT873340	hsa-miR-155	CLIP-seq
MIRT873341	hsa-miR-369-5p	CLIP-seq
MIRT873342	hsa-miR-4738-3p	CLIP-seq
MIRT873343	hsa-miR-539	CLIP-seq
MIRT873344	hsa-miR-582-3p	CLIP-seq
MIRT873345	hsa-miR-297	CLIP-seq
MIRT873346	hsa-miR-3148	CLIP-seq
MIRT873347	hsa-miR-3149	CLIP-seq
MIRT873348	hsa-miR-3662	CLIP-seq
MIRT873349	hsa-miR-3688-3p	CLIP-seq
MIRT873341	hsa-miR-369-5p	CLIP-seq
MIRT873350	hsa-miR-425	CLIP-seq
MIRT873351	hsa-miR-4462	CLIP-seq
MIRT873342	hsa-miR-4738-3p	CLIP-seq
MIRT873352	hsa-miR-548al	CLIP-seq
MIRT873344	hsa-miR-582-3p	CLIP-seq
MIRT1959123	hsa-miR-3974	CLIP-seq
MIRT1959124	hsa-miR-4506	CLIP-seq
MIRT1959125	hsa-miR-493	CLIP-seq
MIRT1959126	hsa-miR-518a-3p	CLIP-seq
MIRT1959127	hsa-miR-518b	CLIP-seq
MIRT1959128	hsa-miR-518c	CLIP-seq
MIRT1959129	hsa-miR-518d-3p	CLIP-seq
MIRT1959130	hsa-miR-518f	CLIP-seq
MIRT2499125	hsa-miR-3684	CLIP-seq
MIRT2499126	hsa-miR-3692	CLIP-seq
MIRT1959123	hsa-miR-3974	CLIP-seq
MIRT873351	hsa-miR-4462	CLIP-seq
MIRT2499127	hsa-miR-4477b	CLIP-seq
MIRT1959124	hsa-miR-4506	CLIP-seq
MIRT873342	hsa-miR-4738-3p	CLIP-seq
MIRT2499128	hsa-miR-4778-3p	CLIP-seq
MIRT1959125	hsa-miR-493	CLIP-seq
MIRT1959126	hsa-miR-518a-3p	CLIP-seq
MIRT1959127	hsa-miR-518b	CLIP-seq
MIRT1959128	hsa-miR-518c	CLIP-seq
MIRT1959129	hsa-miR-518d-3p	CLIP-seq
MIRT1959130	hsa-miR-518f	CLIP-seq
MIRT873352	hsa-miR-548al	CLIP-seq
MIRT2499129	hsa-miR-633	CLIP-seq
MIRT2499125	hsa-miR-3684	CLIP-seq
MIRT2499126	hsa-miR-3692	CLIP-seq
MIRT1959123	hsa-miR-3974	CLIP-seq
MIRT873351	hsa-miR-4462	CLIP-seq
MIRT2499127	hsa-miR-4477b	CLIP-seq
MIRT1959124	hsa-miR-4506	CLIP-seq
MIRT2499128	hsa-miR-4778-3p	CLIP-seq
MIRT1959125	hsa-miR-493	CLIP-seq
MIRT1959126	hsa-miR-518a-3p	CLIP-seq
MIRT1959127	hsa-miR-518b	CLIP-seq
MIRT1959128	hsa-miR-518c	CLIP-seq
MIRT1959129	hsa-miR-518d-3p	CLIP-seq
MIRT1959130	hsa-miR-518f	CLIP-seq
MIRT873352	hsa-miR-548al	CLIP-seq
MIRT2499129	hsa-miR-633	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002199	Component	Zona pellucida receptor complex	IEA
GO:0005515	Function	Protein binding	IPI	14532270, 16085932, 16097032, 17429077, 20080638, 22500027, 25416956, 25467444, 27353360, 28514442, 30021884, 32296183, 32814053, 33144677, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	NAS	11532003
GO:0005829	Component	Cytosol	TAS
GO:0005832	Component	Chaperonin-containing T-complex	IBA
GO:0005832	Component	Chaperonin-containing T-complex	IDA	23011926, 25467444, 30955883
GO:0005832	Component	Chaperonin-containing T-complex	IEA
GO:0005832	Component	Chaperonin-containing T-complex	IPI	22133715
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005874	Component	Microtubule	IEA
GO:0006457	Process	Protein folding	IBA
GO:0006457	Process	Protein folding	IDA	22133715, 30955883
GO:0006457	Process	Protein folding	IEA
GO:0006457	Process	Protein folding	IMP	25467444
GO:0006457	Process	Protein folding	NAS	11532003
GO:0007339	Process	Binding of sperm to zona pellucida	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21753002
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IEA
GO:0032212	Process	Positive regulation of telomere maintenance via telomerase	IMP	25467444
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0044183	Function	Protein folding chaperone	IDA	25467444, 30955883
GO:0044183	Function	Protein folding chaperone	IEA
GO:0044297	Component	Cell body	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IMP	25467444
GO:0051082	Function	Unfolded protein binding	IBA
GO:0051082	Function	Unfolded protein binding	IEA
GO:0051082	Function	Unfolded protein binding	NAS	11532003
GO:0051131	Process	Chaperone-mediated protein complex assembly	IMP	20080638
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0090666	Process	ScaRNA localization to Cajal body	IMP	25467444
GO:0140662	Function	ATP-dependent protein folding chaperone	IEA
GO:1904871	Process	Positive regulation of protein localization to Cajal body	HMP	25467444
GO:1904874	Process	Positive regulation of telomerase RNA localization to Cajal body	IMP	25467444

MIM	HGNC	e!Ensembl
605139	1615	ENSG00000166226

P78371

Protein name

T-complex protein 1 subunit beta (TCP-1-beta) (EC 3.6.1.-) (CCT-beta) (Chaperonin containing T-complex polypeptide 1 subunit 2)

Protein function

Component of the chaperonin-containing T-complex (TRiC), a molecular chaperone complex that assists the folding of actin, tubulin and other proteins upon ATP hydrolysis (PubMed:25467444, PubMed:36493755, PubMed:35449234, PubMed:37193829). The TR

PDB

6NR8 , 6NR9 , 6NRA , 6NRB , 6NRC , 6NRD , 6QB8 , 7LUM , 7LUP , 7NVL , 7NVM , 7NVN , 7NVO , 7TRG , 7TTN , 7TTT , 7TUB , 7WU7 , 7WZ3 , 7X0A , 7X0S , 7X0V , 7X3J , 7X3U , 7X6Q , 7X7Y , 8HKI , 8I1U , 8I9U , 8IB8 , 8SFE , 8SFF , 8SG8 , 8SG9 , 8SGC , 8SGL , 8SGQ , 8SH9 , 8SHA , 8SHD , 8SHE , 8SHF , 8SHG , 8SHL , 8SHN , 8SHO , 8SHP , 8SHQ , 8SHT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00118	Cpn60_TCP1	35 → 525	TCP-1/cpn60 chaperonin family	Family

Sequence

MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAS
LMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKK
IHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFT
KLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIA
NTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYP
EQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLI
HFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA
VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDM
REGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC

Sequence length

535

Interactions

View interactions

	Reactome
			Association of TriC/CCT with target proteins during biosynthesis BBSome-mediated cargo-targeting to cilium Neutrophil degranulation Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leber congenital amaurosis	Conflicting classifications of pathogenicity	ClinVar Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal dystrophy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINITIS PIGMENTOSA 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	31984950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber, type 1	Leber congenital amaurosis	BEFREE	27645772, 29450543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25704758, 27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27012814	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31101846, 38358781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	27012814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11795471	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29299146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11795471	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31462707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11795471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28926063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25944975, 28926063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25944975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23782473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30451371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30451371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36076300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	23782473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	29483666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	7616551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25944975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25944975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leber Congenital Amaurosis	Leber Congenital Amaurosis	BEFREE	27645772, 29450543		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Leber Congenital Amaurosis	Leber congenital amaurosis	Pubtator	37644231	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23782473	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25704758, 27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29299146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30897525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27012814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32410217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	25944975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31101846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30897525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29299146		★★★★★ ★☆☆☆☆ Found in Text Mining only

CCT2 (chaperonin containing TCP1 subunit 2)