Gene Gene information from NCBI Gene database.
Entrez ID 10568
Gene name Solute carrier family 34 member 2
Gene symbol SLC34A2
Synonyms (NCBI Gene)
NAPI-3BNAPI-IIbNPTIIbNaPi2bPULAM
Chromosome 4
Chromosome location 4p15.2
Summary The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different i
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs137853141 C>T Pathogenic Stop gained, coding sequence variant
rs137853142 G>A,C Pathogenic Missense variant, coding sequence variant
rs796065044 ACCTACCCACTCT>- Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
96
miRTarBase ID miRNA Experiments Reference
MIRT017160 hsa-miR-335-5p Microarray 18185580
MIRT029102 hsa-miR-26b-5p Microarray 19088304
MIRT1360018 hsa-miR-1254 CLIP-seq
MIRT1360019 hsa-miR-1261 CLIP-seq
MIRT1360020 hsa-miR-140-5p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
NFIC Activation 15458926
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
35
GO ID Ontology Definition Evidence Reference
GO:0001701 Process In utero embryonic development IEA
GO:0005436 Function Sodium:phosphate symporter activity IBA
GO:0005436 Function Sodium:phosphate symporter activity IDA 10329428, 10610722, 12488042
GO:0005436 Function Sodium:phosphate symporter activity IEA
GO:0005436 Function Sodium:phosphate symporter activity TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604217 11020 ENSG00000157765
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95436
Protein name Sodium-dependent phosphate transport protein 2B (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi3b) (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (NaPi-2b) (Solute carrier family 34 member 2)
Protein function Involved in actively transporting phosphate into cells via Na(+) cotransport.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02690 Na_Pi_cotrans 110 249 Na+/Pi-cotransporter Family
PF02690 Na_Pi_cotrans 374 576 Na+/Pi-cotransporter Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium. {ECO:0000269|PubMed:10329428, EC
Sequence
MAPWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKTDNTEAPVTKIELLPSYSTATLI
DEPTEVDDPWNLPTLQDSGIKWSERDTKGKILCFFQGIGRLILLLGFLYFFVCSLDILSS
AFQLVGGKMAGQFFSNSSIMSNPLLGLVIGVLVTVLVQSSSTSTSIVVSMVSSSLLTVRA
AIPIIMGANIGTSITNTIVALMQVGDRSEFRRAFAGATVHDFFNWLSVLVLLPVEVATHY
LEIITQLIV
ESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVK
IWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLP
DLAVGTILLILSLLVLCGCLIMIVKILGSVLKGQVATVIKKTINTDFPFPFAWLTGYLAI
LVGAGMTFIVQSSSVFTSALTPLIGIGVITIERAYPLTLGSNIGTTTTAILAALASPGNA
LRSSLQIALCHFFFNISGILLWYPIPFTRLPIRMAKGLGNISAKYRWFAVFYLIIFFFLI
PLTVFGLSLAGWRVLVGVGVPVVFIIILVLCLRLLQ
SRCPRVLPKKLQNWNFLPLWMRSL
KPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVK
APETFDNITISREAQGEVPASDSKTECTAL
Sequence length 690
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Parathyroid hormone synthesis, secretion and action
Mineral absorption
  Type II Na+/Pi cotransporters
Defective SLC34A2 causes pulmonary alveolar microlithiasis (PALM)
Surfactant metabolism
Defective SLC34A2 causes pulmonary alveolar microlithiasis (PALM)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Hereditary breast ovarian cancer syndrome Likely pathogenic rs1714268814 RCV001374511
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PULMONARY ALVEOLAR MICROLITHIASIS Likely pathogenic; Pathogenic rs777320214, rs796065044, rs2474744592, rs2474755725, rs137853141, rs137853142, rs2474777637 RCV004760311
RCV000190366
RCV000006068
RCV000006069
RCV000006070
View all (2 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CARCINOMA, NON-SMALL-CELL LUNG CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SLC34A2-related disorder Benign; Likely benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 25017204, 26156586, 28720066
★☆☆☆☆
Found in Text Mining only
Bladder Neoplasm Bladder Neoplasm BEFREE 28151475
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 21036732, 26546432, 28381172, 29415049
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 34944522 Associate
★☆☆☆☆
Found in Text Mining only
Cancer Pain Cancer Pubtator 34944522 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 26156586 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 28281971
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 28281971 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of bladder Bladder carcinoma BEFREE 28151475
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 25017204, 26910912
★☆☆☆☆
Found in Text Mining only