Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10553
Gene name	HIV-1 Tat interactive protein 2
Gene symbol	HTATIP2
Synonyms (NCBI Gene)	CC3SDR44U1TIP30
Chromosome	11
Chromosome location	11p15.1

218

Show/Hide all (218)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002630	hsa-miR-124-3p	Microarray	15685193
MIRT002630	hsa-miR-124-3p	Microarray	15685193
MIRT002630	hsa-miR-124-3p	Microarray	18668037
MIRT437374	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	24096486
MIRT437374	hsa-miR-10b-5p	Luciferase reporter assayqRT-PCRWestern blot	24096486
MIRT1057092	hsa-miR-1245	CLIP-seq
MIRT1057093	hsa-miR-125a-5p	CLIP-seq
MIRT1057094	hsa-miR-125b	CLIP-seq
MIRT1057095	hsa-miR-3158-3p	CLIP-seq
MIRT1057096	hsa-miR-3924	CLIP-seq
MIRT1057097	hsa-miR-4319	CLIP-seq
MIRT1057098	hsa-miR-4446-3p	CLIP-seq
MIRT1057099	hsa-miR-4656	CLIP-seq
MIRT1057100	hsa-miR-4732-3p	CLIP-seq
MIRT1057101	hsa-miR-4762-5p	CLIP-seq
MIRT1057102	hsa-miR-4765	CLIP-seq
MIRT1057103	hsa-miR-568	CLIP-seq
MIRT1057104	hsa-miR-670	CLIP-seq
MIRT1057105	hsa-miR-1184	CLIP-seq
MIRT1057106	hsa-miR-1205	CLIP-seq
MIRT1057107	hsa-miR-142-3p	CLIP-seq
MIRT1057108	hsa-miR-3065-5p	CLIP-seq
MIRT1057109	hsa-miR-3158-5p	CLIP-seq
MIRT1057110	hsa-miR-3166	CLIP-seq
MIRT1057111	hsa-miR-330-3p	CLIP-seq
MIRT1057112	hsa-miR-3606	CLIP-seq
MIRT1057113	hsa-miR-3919	CLIP-seq
MIRT1057114	hsa-miR-4275	CLIP-seq
MIRT1057115	hsa-miR-4522	CLIP-seq
MIRT1057116	hsa-miR-4666-5p	CLIP-seq
MIRT1057117	hsa-miR-4731-3p	CLIP-seq
MIRT1057118	hsa-miR-4756-3p	CLIP-seq
MIRT1057119	hsa-miR-4771	CLIP-seq
MIRT1057120	hsa-miR-4801	CLIP-seq
MIRT1057121	hsa-miR-505	CLIP-seq
MIRT1057122	hsa-miR-590-3p	CLIP-seq
MIRT1057123	hsa-miR-607	CLIP-seq
MIRT1057124	hsa-miR-2467-3p	CLIP-seq
MIRT1057125	hsa-miR-3155	CLIP-seq
MIRT1057126	hsa-miR-3155b	CLIP-seq
MIRT1057127	hsa-miR-3678-3p	CLIP-seq
MIRT1057128	hsa-miR-4539	CLIP-seq
MIRT1057129	hsa-miR-484	CLIP-seq
MIRT1057130	hsa-miR-760	CLIP-seq
MIRT2013036	hsa-miR-124	CLIP-seq
MIRT1057092	hsa-miR-1245	CLIP-seq
MIRT1057093	hsa-miR-125a-5p	CLIP-seq
MIRT1057094	hsa-miR-125b	CLIP-seq
MIRT1057107	hsa-miR-142-3p	CLIP-seq
MIRT1057112	hsa-miR-3606	CLIP-seq
MIRT1057096	hsa-miR-3924	CLIP-seq
MIRT2013037	hsa-miR-3941	CLIP-seq
MIRT1057114	hsa-miR-4275	CLIP-seq
MIRT1057097	hsa-miR-4319	CLIP-seq
MIRT2013038	hsa-miR-4484	CLIP-seq
MIRT2013039	hsa-miR-466	CLIP-seq
MIRT1057116	hsa-miR-4666-5p	CLIP-seq
MIRT2013040	hsa-miR-4672	CLIP-seq
MIRT1057117	hsa-miR-4731-3p	CLIP-seq
MIRT1057100	hsa-miR-4732-3p	CLIP-seq
MIRT1057102	hsa-miR-4765	CLIP-seq
MIRT1057120	hsa-miR-4801	CLIP-seq
MIRT2013041	hsa-miR-506	CLIP-seq
MIRT2013042	hsa-miR-548an	CLIP-seq
MIRT1057104	hsa-miR-670	CLIP-seq
MIRT2548536	hsa-miR-1	CLIP-seq
MIRT1057105	hsa-miR-1184	CLIP-seq
MIRT2548537	hsa-miR-1185	CLIP-seq
MIRT1057106	hsa-miR-1205	CLIP-seq
MIRT1057092	hsa-miR-1245	CLIP-seq
MIRT1057093	hsa-miR-125a-5p	CLIP-seq
MIRT1057094	hsa-miR-125b	CLIP-seq
MIRT2548538	hsa-miR-1303	CLIP-seq
MIRT2548539	hsa-miR-134	CLIP-seq
MIRT1057107	hsa-miR-142-3p	CLIP-seq
MIRT2548540	hsa-miR-206	CLIP-seq
MIRT2548541	hsa-miR-2278	CLIP-seq
MIRT1057124	hsa-miR-2467-3p	CLIP-seq
MIRT2548542	hsa-miR-29a	CLIP-seq
MIRT2548543	hsa-miR-29b	CLIP-seq
MIRT2548544	hsa-miR-29c	CLIP-seq
MIRT1057108	hsa-miR-3065-5p	CLIP-seq
MIRT2548545	hsa-miR-3118	CLIP-seq
MIRT1057125	hsa-miR-3155	CLIP-seq
MIRT1057126	hsa-miR-3155b	CLIP-seq
MIRT1057109	hsa-miR-3158-5p	CLIP-seq
MIRT2548546	hsa-miR-3164	CLIP-seq
MIRT1057110	hsa-miR-3166	CLIP-seq
MIRT2548547	hsa-miR-3177-3p	CLIP-seq
MIRT1057111	hsa-miR-330-3p	CLIP-seq
MIRT2548548	hsa-miR-3605-5p	CLIP-seq
MIRT1057112	hsa-miR-3606	CLIP-seq
MIRT2548549	hsa-miR-361-3p	CLIP-seq
MIRT2548550	hsa-miR-3663-3p	CLIP-seq
MIRT2548551	hsa-miR-3670	CLIP-seq
MIRT2548552	hsa-miR-3673	CLIP-seq
MIRT1057127	hsa-miR-3678-3p	CLIP-seq
MIRT2548553	hsa-miR-3679-5p	CLIP-seq
MIRT2548554	hsa-miR-3684	CLIP-seq
MIRT1057113	hsa-miR-3919	CLIP-seq
MIRT1057096	hsa-miR-3924	CLIP-seq
MIRT2013037	hsa-miR-3941	CLIP-seq
MIRT2548555	hsa-miR-4271	CLIP-seq
MIRT1057114	hsa-miR-4275	CLIP-seq
MIRT1057097	hsa-miR-4319	CLIP-seq
MIRT2548556	hsa-miR-4468	CLIP-seq
MIRT1057115	hsa-miR-4522	CLIP-seq
MIRT1057128	hsa-miR-4539	CLIP-seq
MIRT2548557	hsa-miR-4642	CLIP-seq
MIRT2013039	hsa-miR-466	CLIP-seq
MIRT1057116	hsa-miR-4666-5p	CLIP-seq
MIRT2013040	hsa-miR-4672	CLIP-seq
MIRT2548558	hsa-miR-4676-5p	CLIP-seq
MIRT2548559	hsa-miR-4690-5p	CLIP-seq
MIRT2548560	hsa-miR-4711-5p	CLIP-seq
MIRT2548561	hsa-miR-4725-3p	CLIP-seq
MIRT2548562	hsa-miR-4725-5p	CLIP-seq
MIRT2548563	hsa-miR-4728-3p	CLIP-seq
MIRT1057117	hsa-miR-4731-3p	CLIP-seq
MIRT1057100	hsa-miR-4732-3p	CLIP-seq
MIRT1057118	hsa-miR-4756-3p	CLIP-seq
MIRT1057101	hsa-miR-4762-5p	CLIP-seq
MIRT1057102	hsa-miR-4765	CLIP-seq
MIRT1057119	hsa-miR-4771	CLIP-seq
MIRT1057120	hsa-miR-4801	CLIP-seq
MIRT1057129	hsa-miR-484	CLIP-seq
MIRT2548564	hsa-miR-504	CLIP-seq
MIRT1057121	hsa-miR-505	CLIP-seq
MIRT2548565	hsa-miR-507	CLIP-seq
MIRT2548566	hsa-miR-509-3p	CLIP-seq
MIRT2548567	hsa-miR-526b	CLIP-seq
MIRT2548568	hsa-miR-544b	CLIP-seq
MIRT2548569	hsa-miR-557	CLIP-seq
MIRT1057103	hsa-miR-568	CLIP-seq
MIRT2548570	hsa-miR-575	CLIP-seq
MIRT2548571	hsa-miR-578	CLIP-seq
MIRT2548572	hsa-miR-579	CLIP-seq
MIRT1057122	hsa-miR-590-3p	CLIP-seq
MIRT2548573	hsa-miR-604	CLIP-seq
MIRT1057123	hsa-miR-607	CLIP-seq
MIRT2548574	hsa-miR-613	CLIP-seq
MIRT2548575	hsa-miR-628-5p	CLIP-seq
MIRT2548576	hsa-miR-647	CLIP-seq
MIRT1057104	hsa-miR-670	CLIP-seq
MIRT1057130	hsa-miR-760	CLIP-seq
MIRT2548577	hsa-miR-767-5p	CLIP-seq
MIRT1057115	hsa-miR-4522	CLIP-seq
MIRT2548536	hsa-miR-1	CLIP-seq
MIRT1057105	hsa-miR-1184	CLIP-seq
MIRT2548537	hsa-miR-1185	CLIP-seq
MIRT1057106	hsa-miR-1205	CLIP-seq
MIRT1057092	hsa-miR-1245	CLIP-seq
MIRT1057093	hsa-miR-125a-5p	CLIP-seq
MIRT1057094	hsa-miR-125b	CLIP-seq
MIRT2548538	hsa-miR-1303	CLIP-seq
MIRT1057107	hsa-miR-142-3p	CLIP-seq
MIRT2548540	hsa-miR-206	CLIP-seq
MIRT2548541	hsa-miR-2278	CLIP-seq
MIRT1057124	hsa-miR-2467-3p	CLIP-seq
MIRT2548542	hsa-miR-29a	CLIP-seq
MIRT2548543	hsa-miR-29b	CLIP-seq
MIRT2548544	hsa-miR-29c	CLIP-seq
MIRT1057108	hsa-miR-3065-5p	CLIP-seq
MIRT1057125	hsa-miR-3155	CLIP-seq
MIRT1057126	hsa-miR-3155b	CLIP-seq
MIRT1057109	hsa-miR-3158-5p	CLIP-seq
MIRT1057110	hsa-miR-3166	CLIP-seq
MIRT2548547	hsa-miR-3177-3p	CLIP-seq
MIRT1057111	hsa-miR-330-3p	CLIP-seq
MIRT2548548	hsa-miR-3605-5p	CLIP-seq
MIRT1057112	hsa-miR-3606	CLIP-seq
MIRT2548549	hsa-miR-361-3p	CLIP-seq
MIRT2548550	hsa-miR-3663-3p	CLIP-seq
MIRT2548551	hsa-miR-3670	CLIP-seq
MIRT2548552	hsa-miR-3673	CLIP-seq
MIRT1057127	hsa-miR-3678-3p	CLIP-seq
MIRT2548553	hsa-miR-3679-5p	CLIP-seq
MIRT1057113	hsa-miR-3919	CLIP-seq
MIRT1057096	hsa-miR-3924	CLIP-seq
MIRT2013037	hsa-miR-3941	CLIP-seq
MIRT2548555	hsa-miR-4271	CLIP-seq
MIRT1057114	hsa-miR-4275	CLIP-seq
MIRT1057097	hsa-miR-4319	CLIP-seq
MIRT2548556	hsa-miR-4468	CLIP-seq
MIRT1057115	hsa-miR-4522	CLIP-seq
MIRT1057128	hsa-miR-4539	CLIP-seq
MIRT2548557	hsa-miR-4642	CLIP-seq
MIRT2013039	hsa-miR-466	CLIP-seq
MIRT1057116	hsa-miR-4666-5p	CLIP-seq
MIRT2013040	hsa-miR-4672	CLIP-seq
MIRT2548558	hsa-miR-4676-5p	CLIP-seq
MIRT2548559	hsa-miR-4690-5p	CLIP-seq
MIRT2548560	hsa-miR-4711-5p	CLIP-seq
MIRT2548561	hsa-miR-4725-3p	CLIP-seq
MIRT1057117	hsa-miR-4731-3p	CLIP-seq
MIRT1057100	hsa-miR-4732-3p	CLIP-seq
MIRT1057118	hsa-miR-4756-3p	CLIP-seq
MIRT1057101	hsa-miR-4762-5p	CLIP-seq
MIRT1057102	hsa-miR-4765	CLIP-seq
MIRT1057119	hsa-miR-4771	CLIP-seq
MIRT1057120	hsa-miR-4801	CLIP-seq
MIRT1057129	hsa-miR-484	CLIP-seq
MIRT1057121	hsa-miR-505	CLIP-seq
MIRT2548565	hsa-miR-507	CLIP-seq
MIRT2548566	hsa-miR-509-3p	CLIP-seq
MIRT2548567	hsa-miR-526b	CLIP-seq
MIRT2548568	hsa-miR-544b	CLIP-seq
MIRT2548569	hsa-miR-557	CLIP-seq
MIRT1057103	hsa-miR-568	CLIP-seq
MIRT2548570	hsa-miR-575	CLIP-seq
MIRT2548571	hsa-miR-578	CLIP-seq
MIRT2548572	hsa-miR-579	CLIP-seq
MIRT1057122	hsa-miR-590-3p	CLIP-seq
MIRT1057123	hsa-miR-607	CLIP-seq
MIRT2548574	hsa-miR-613	CLIP-seq
MIRT1057104	hsa-miR-670	CLIP-seq
MIRT1057130	hsa-miR-760	CLIP-seq
MIRT2548577	hsa-miR-767-5p	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10698937
GO:0005515	Function	Protein binding	IPI	15282309, 30614533, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15282309
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IDA
GO:0006417	Process	Regulation of translation	IEA
GO:0043068	Process	Positive regulation of programmed cell death	IDA	10698937
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10698937
GO:0046777	Process	Protein autophosphorylation	IDA	10698937

MIM	HGNC	e!Ensembl
605628	16637	ENSG00000109854

Q9BUP3

Protein name

Protein HTATIP2 (30 kDa HIV-1 TAT-interacting protein) (HIV-1 TAT-interactive protein 2)

Protein function

Represses translation by preventing reactivation of elongation factor eEF1A (By similarity). May also inhibit nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors (PubMed:15282309). Ha

PDB

2BKA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13460	NAD_binding_10	25 → 214	NAD(P)H-binding	Domain

Tissue specificity

TISSUE SPECIFICITY: High levels in liver, lung, skeletal muscle, pancreas and placenta (PubMed:9174052). Moderate levels in heart and kidney (PubMed:9174052). Low levels in brain (PubMed:9174052). Not expressed or low levels in variant small cell lung car

Sequence

MAETEALSKLREDFRMQNKSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEE
AYKNVNQEVVDFEKLDDYASAFQGHDVGFCCLGTTRGKAGAEGFVRVDRDYVLKSAELAK
AGGCKHFNLLSSKGADKSSNFLYLQVKGEVEAKVEELKFDRYSVFRPGVLLCDRQESRPG
EWLVRKFFGSLPDSWASGHSVPVVTVVRAMLNNVVRPRDKQMELLENKAIHDLGKAHGSL
KP

Sequence length

242

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BELL'S PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22733137		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24037692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25612666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25612666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30249892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15931508, 17097132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15931508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15633220, 17997990, 25008315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30249892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19349353, 30099830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27748889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31205552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29359783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19798571, 27837314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29359783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36817429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31205552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25544767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27893424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27893424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	27748889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	27748889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37491696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25617528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26718891	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	15633220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	15633220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	38303513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31468715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	31468715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	17440068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14695192, 15633220, 16799960, 17440068, 17997990, 18519672, 18537194, 19010857, 23741443, 24681951, 26629947, 26752068, 27418384, 28599422, 28604762, 29654226, 30402840 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16799960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18519672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22733137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27748889	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38303513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15931508, 17097132, 17440068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	27748889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19349353, 30099830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24037692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18528861, 19798571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30249892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14695192, 19349353, 28036326, 30249892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	18664619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19104151, 19839715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	19104151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14695192, 15633220, 16799960, 17097132, 17440068, 18528861, 18537194, 19084528, 19349353, 19798571, 20461752, 22733137, 23741443, 24037692, 24681951 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19349353, 22733137, 30099830, 30642057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23800048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24037692		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18528861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18528861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17097132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19349353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	25312779, 25544767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18972434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38303513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	29336367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29336367	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30249892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HTATIP2 (HIV-1 Tat interactive protein 2)