Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10544
Gene name	Protein C receptor
Gene symbol	PROCR
Synonyms (NCBI Gene)	CCCACCD41EPCR
Chromosome	20
Chromosome location	20q11.22
Summary	The protein encoded by this gene is a receptor for activated protein C, a serine protease activated by and involved in the blood coagulation pathway. The encoded protein is an N-glycosylated type I membrane protein that enhances the activation of protein

199

Show/Hide all (199)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019919	hsa-miR-375	Microarray	20215506
MIRT023818	hsa-miR-1-3p	Proteomics	18668040
MIRT037191	hsa-miR-877-3p	CLASH	23622248
MIRT1265035	hsa-miR-181a	CLIP-seq
MIRT1265036	hsa-miR-181b	CLIP-seq
MIRT1265037	hsa-miR-181c	CLIP-seq
MIRT1265038	hsa-miR-181d	CLIP-seq
MIRT1265039	hsa-miR-361-5p	CLIP-seq
MIRT1265040	hsa-miR-4262	CLIP-seq
MIRT1265041	hsa-miR-4477a	CLIP-seq
MIRT1265042	hsa-miR-4494	CLIP-seq
MIRT1265043	hsa-miR-499a-5p	CLIP-seq
MIRT1265044	hsa-miR-543	CLIP-seq
MIRT1265045	hsa-miR-577	CLIP-seq
MIRT1265046	hsa-miR-656	CLIP-seq
MIRT1265047	hsa-miR-889	CLIP-seq
MIRT1556847	hsa-miR-3692	CLIP-seq
MIRT2077894	hsa-miR-1228	CLIP-seq
MIRT2077895	hsa-miR-1237	CLIP-seq
MIRT2077896	hsa-miR-1255a	CLIP-seq
MIRT2077897	hsa-miR-1255b	CLIP-seq
MIRT2077898	hsa-miR-219-5p	CLIP-seq
MIRT2077899	hsa-miR-329	CLIP-seq
MIRT2077900	hsa-miR-330-3p	CLIP-seq
MIRT2077901	hsa-miR-3613-5p	CLIP-seq
MIRT2077902	hsa-miR-362-3p	CLIP-seq
MIRT2077903	hsa-miR-3691-5p	CLIP-seq
MIRT2077904	hsa-miR-409-3p	CLIP-seq
MIRT2077905	hsa-miR-4291	CLIP-seq
MIRT2077906	hsa-miR-4422	CLIP-seq
MIRT2077907	hsa-miR-4445	CLIP-seq
MIRT2077908	hsa-miR-4752	CLIP-seq
MIRT2077909	hsa-miR-4760-3p	CLIP-seq
MIRT2077910	hsa-miR-4782-3p	CLIP-seq
MIRT2077911	hsa-miR-508-3p	CLIP-seq
MIRT2077912	hsa-miR-545	CLIP-seq
MIRT2077913	hsa-miR-619	CLIP-seq
MIRT2077914	hsa-miR-642b	CLIP-seq
MIRT2601300	hsa-miR-1202	CLIP-seq
MIRT2077894	hsa-miR-1228	CLIP-seq
MIRT2077895	hsa-miR-1237	CLIP-seq
MIRT2077896	hsa-miR-1255a	CLIP-seq
MIRT2077897	hsa-miR-1255b	CLIP-seq
MIRT2601301	hsa-miR-125a-3p	CLIP-seq
MIRT2601302	hsa-miR-128	CLIP-seq
MIRT2601303	hsa-miR-136	CLIP-seq
MIRT2601304	hsa-miR-149	CLIP-seq
MIRT2601305	hsa-miR-1913	CLIP-seq
MIRT2601306	hsa-miR-204	CLIP-seq
MIRT2601307	hsa-miR-211	CLIP-seq
MIRT2601308	hsa-miR-2110	CLIP-seq
MIRT2077898	hsa-miR-219-5p	CLIP-seq
MIRT2601309	hsa-miR-2392	CLIP-seq
MIRT2601310	hsa-miR-27a	CLIP-seq
MIRT2601311	hsa-miR-27b	CLIP-seq
MIRT2601312	hsa-miR-3064-5p	CLIP-seq
MIRT2601313	hsa-miR-3074-5p	CLIP-seq
MIRT2601314	hsa-miR-3120-5p	CLIP-seq
MIRT2601315	hsa-miR-3145-5p	CLIP-seq
MIRT2601316	hsa-miR-3150a-3p	CLIP-seq
MIRT2601317	hsa-miR-3175	CLIP-seq
MIRT2601318	hsa-miR-3189-5p	CLIP-seq
MIRT2601319	hsa-miR-3194-5p	CLIP-seq
MIRT2601320	hsa-miR-324-3p	CLIP-seq
MIRT2077899	hsa-miR-329	CLIP-seq
MIRT2601321	hsa-miR-3605-5p	CLIP-seq
MIRT2077901	hsa-miR-3613-5p	CLIP-seq
MIRT2077902	hsa-miR-362-3p	CLIP-seq
MIRT2077903	hsa-miR-3691-5p	CLIP-seq
MIRT1556847	hsa-miR-3692	CLIP-seq
MIRT2601322	hsa-miR-3934	CLIP-seq
MIRT2601323	hsa-miR-3972	CLIP-seq
MIRT2077904	hsa-miR-409-3p	CLIP-seq
MIRT2601324	hsa-miR-4259	CLIP-seq
MIRT2601325	hsa-miR-4294	CLIP-seq
MIRT2601326	hsa-miR-4299	CLIP-seq
MIRT2601327	hsa-miR-4443	CLIP-seq
MIRT2077907	hsa-miR-4445	CLIP-seq
MIRT2601328	hsa-miR-4446-5p	CLIP-seq
MIRT2601329	hsa-miR-4456	CLIP-seq
MIRT2601330	hsa-miR-4640-5p	CLIP-seq
MIRT2601331	hsa-miR-4694-5p	CLIP-seq
MIRT2601332	hsa-miR-4722-3p	CLIP-seq
MIRT2601333	hsa-miR-4726-5p	CLIP-seq
MIRT2601334	hsa-miR-4738-3p	CLIP-seq
MIRT2077908	hsa-miR-4752	CLIP-seq
MIRT2601335	hsa-miR-4755-5p	CLIP-seq
MIRT2601336	hsa-miR-4758-3p	CLIP-seq
MIRT2601337	hsa-miR-4778-5p	CLIP-seq
MIRT2601338	hsa-miR-4780	CLIP-seq
MIRT2077910	hsa-miR-4782-3p	CLIP-seq
MIRT2601339	hsa-miR-4794	CLIP-seq
MIRT2601340	hsa-miR-483-3p	CLIP-seq
MIRT2077911	hsa-miR-508-3p	CLIP-seq
MIRT2601341	hsa-miR-511	CLIP-seq
MIRT2601342	hsa-miR-513a-5p	CLIP-seq
MIRT2601343	hsa-miR-516a-3p	CLIP-seq
MIRT2601344	hsa-miR-548q	CLIP-seq
MIRT2601345	hsa-miR-614	CLIP-seq
MIRT2077913	hsa-miR-619	CLIP-seq
MIRT2601346	hsa-miR-623	CLIP-seq
MIRT2077914	hsa-miR-642b	CLIP-seq
MIRT2601347	hsa-miR-659	CLIP-seq
MIRT2601348	hsa-miR-668	CLIP-seq
MIRT2601349	hsa-miR-764	CLIP-seq
MIRT2601350	hsa-miR-765	CLIP-seq
MIRT2601351	hsa-miR-885-5p	CLIP-seq
MIRT2601352	hsa-miR-887	CLIP-seq
MIRT2601353	hsa-miR-9	CLIP-seq
MIRT2601354	hsa-miR-939	CLIP-seq
MIRT2601300	hsa-miR-1202	CLIP-seq
MIRT2077894	hsa-miR-1228	CLIP-seq
MIRT2077895	hsa-miR-1237	CLIP-seq
MIRT2077896	hsa-miR-1255a	CLIP-seq
MIRT2077897	hsa-miR-1255b	CLIP-seq
MIRT2601301	hsa-miR-125a-3p	CLIP-seq
MIRT2601302	hsa-miR-128	CLIP-seq
MIRT2688654	hsa-miR-1290	CLIP-seq
MIRT2601303	hsa-miR-136	CLIP-seq
MIRT2601304	hsa-miR-149	CLIP-seq
MIRT2601305	hsa-miR-1913	CLIP-seq
MIRT2601306	hsa-miR-204	CLIP-seq
MIRT2601307	hsa-miR-211	CLIP-seq
MIRT2601308	hsa-miR-2110	CLIP-seq
MIRT2077898	hsa-miR-219-5p	CLIP-seq
MIRT2601309	hsa-miR-2392	CLIP-seq
MIRT2601310	hsa-miR-27a	CLIP-seq
MIRT2601311	hsa-miR-27b	CLIP-seq
MIRT2601312	hsa-miR-3064-5p	CLIP-seq
MIRT2688655	hsa-miR-3074-3p	CLIP-seq
MIRT2601313	hsa-miR-3074-5p	CLIP-seq
MIRT2601314	hsa-miR-3120-5p	CLIP-seq
MIRT2688656	hsa-miR-3127-3p	CLIP-seq
MIRT2601315	hsa-miR-3145-5p	CLIP-seq
MIRT2601316	hsa-miR-3150a-3p	CLIP-seq
MIRT2688657	hsa-miR-3160-3p	CLIP-seq
MIRT2688658	hsa-miR-3167	CLIP-seq
MIRT2601317	hsa-miR-3175	CLIP-seq
MIRT2688659	hsa-miR-3184	CLIP-seq
MIRT2601318	hsa-miR-3189-5p	CLIP-seq
MIRT2601319	hsa-miR-3194-5p	CLIP-seq
MIRT2601320	hsa-miR-324-3p	CLIP-seq
MIRT2077899	hsa-miR-329	CLIP-seq
MIRT2601321	hsa-miR-3605-5p	CLIP-seq
MIRT2077901	hsa-miR-3613-5p	CLIP-seq
MIRT2077902	hsa-miR-362-3p	CLIP-seq
MIRT2688660	hsa-miR-3676	CLIP-seq
MIRT2688661	hsa-miR-3682-5p	CLIP-seq
MIRT2077903	hsa-miR-3691-5p	CLIP-seq
MIRT1556847	hsa-miR-3692	CLIP-seq
MIRT2601322	hsa-miR-3934	CLIP-seq
MIRT2601323	hsa-miR-3972	CLIP-seq
MIRT2077904	hsa-miR-409-3p	CLIP-seq
MIRT2688662	hsa-miR-423-5p	CLIP-seq
MIRT2601324	hsa-miR-4259	CLIP-seq
MIRT2601325	hsa-miR-4294	CLIP-seq
MIRT2601326	hsa-miR-4299	CLIP-seq
MIRT2688663	hsa-miR-4303	CLIP-seq
MIRT2601327	hsa-miR-4443	CLIP-seq
MIRT2077907	hsa-miR-4445	CLIP-seq
MIRT2601328	hsa-miR-4446-5p	CLIP-seq
MIRT2601329	hsa-miR-4456	CLIP-seq
MIRT2688664	hsa-miR-4487	CLIP-seq
MIRT2601330	hsa-miR-4640-5p	CLIP-seq
MIRT2688665	hsa-miR-4649-3p	CLIP-seq
MIRT2688666	hsa-miR-4662a-3p	CLIP-seq
MIRT2601331	hsa-miR-4694-5p	CLIP-seq
MIRT2601332	hsa-miR-4722-3p	CLIP-seq
MIRT2601333	hsa-miR-4726-5p	CLIP-seq
MIRT2601334	hsa-miR-4738-3p	CLIP-seq
MIRT2077908	hsa-miR-4752	CLIP-seq
MIRT2601335	hsa-miR-4755-5p	CLIP-seq
MIRT2601336	hsa-miR-4758-3p	CLIP-seq
MIRT2688667	hsa-miR-4778-3p	CLIP-seq
MIRT2601337	hsa-miR-4778-5p	CLIP-seq
MIRT2601338	hsa-miR-4780	CLIP-seq
MIRT2077910	hsa-miR-4782-3p	CLIP-seq
MIRT2601339	hsa-miR-4794	CLIP-seq
MIRT2601340	hsa-miR-483-3p	CLIP-seq
MIRT2077911	hsa-miR-508-3p	CLIP-seq
MIRT2601341	hsa-miR-511	CLIP-seq
MIRT2601342	hsa-miR-513a-5p	CLIP-seq
MIRT2601343	hsa-miR-516a-3p	CLIP-seq
MIRT2601344	hsa-miR-548q	CLIP-seq
MIRT2688668	hsa-miR-558	CLIP-seq
MIRT2601345	hsa-miR-614	CLIP-seq
MIRT2077913	hsa-miR-619	CLIP-seq
MIRT2601346	hsa-miR-623	CLIP-seq
MIRT2077914	hsa-miR-642b	CLIP-seq
MIRT2601347	hsa-miR-659	CLIP-seq
MIRT2601348	hsa-miR-668	CLIP-seq
MIRT2601349	hsa-miR-764	CLIP-seq
MIRT2601350	hsa-miR-765	CLIP-seq
MIRT2688669	hsa-miR-876-5p	CLIP-seq
MIRT2601351	hsa-miR-885-5p	CLIP-seq
MIRT2601352	hsa-miR-887	CLIP-seq
MIRT2688670	hsa-miR-890	CLIP-seq
MIRT2601353	hsa-miR-9	CLIP-seq
MIRT2601354	hsa-miR-939	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17299037, 20826780
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005886	Component	Plasma membrane	TAS	7929370
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0038023	Function	Signaling receptor activity	TAS	7929370
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050819	Process	Negative regulation of coagulation	IBA
GO:0050819	Process	Negative regulation of coagulation	IMP	19696402
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
600646	9452	ENSG00000101000

Q9UNN8

Protein name

Endothelial protein C receptor (Activated protein C receptor) (APC receptor) (Endothelial cell protein C receptor) (CD antigen CD201)

Protein function

Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.

PDB

1L8J , 1LQV , 3JTC , 4V3D , 4V3E , 6SNY , 7OKS , 7OKT , 7OKU , 7OKV , 7Q5D , 8C44

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16497	MHC_I_3	1 → 199	MHC-I family domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed strongly in the endothelial cells of arteries and veins in heart and lung, less intensely in capillaries in the lung and skin, and not at all in the endothelium of small vessels of the liver and kidney.

Sequence

MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEG
PDTNTTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCEL
PPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELRE
FLEDTCVQYVQKHISAENTKGSQTSRSYTSLVLGVLVGSFIIAGVAVGIFLCTGGRRC

Sequence length

238

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades		Common Pathway of Fibrin Clot Formation Cell surface interactions at the vascular wall

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COR PULMONALE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (116)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	25407022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	19680809, 28007459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31369419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	37791774	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	34115805	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	30048851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28530674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30649471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	17491095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27163155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28530674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	40304040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21851971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	21394629	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	33683204, 36814838, 36982991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	34549725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23593394, 25407022, 28103946, 28756987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20103682, 25407022, 29217770, 29997232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23581230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23877403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18680534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28367652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	17170365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	24495480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	30383853, 40304040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	18977990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12563316, 18680534, 30383853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	28530674		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	23202125		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	26908601, 35264566	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	28530674		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	35264566	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	18680534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15921688, 18680534		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21966275		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	BEFREE	11686350, 12413583, 15304035, 20141580, 21362311, 26340463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15921688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26990852	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	26990852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	25246042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22591734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22591734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22591734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	17659055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	24957146, 25049281, 28932824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	24957146, 25049281, 28932824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35018451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	23741007, 37175682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28756987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25032959, 30383853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	26908601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15954900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23342274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	1406658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24040354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	19004141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15954900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	15954900, 19286697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23593394, 25407022, 28103946, 28756987, 29997232, 31481760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23581230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23877403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25895599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23581230, 23593394, 25049281, 28756987, 29461258, 30008838, 31481760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	18680534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	23539451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	25541704, 34966385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	16052406, 17099210, 22036807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	31645483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	15978102, 18757851		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	18757851		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	18757851	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34462518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35169126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23539451, 23581230, 23593394, 23877403, 27833109, 28756987, 31481760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Non rare thrombophilia	Non Rare Thrombophilia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	22193922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	17491095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23877403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26082331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25061051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	31734630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	22193922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	16363234, 23389250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura Fulminans	Purpura Fulminans	BEFREE	29630665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	27215212, 28732053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29025399, 29107642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	29025399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	15710622, 16444434, 21394629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	16444434, 17454790, 24401906, 25032959, 28415941, 28957875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	35018451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31677485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25895599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18680534, 30383853	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	BEFREE	11776299, 17849044, 30214417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	14576048, 18403391, 19133979, 22193922, 23389250, 25760048, 34981912, 35264566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29217770, 34281556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31481760, 31621698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	23128233, 26192919		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASDB_DG	23128233		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	37308506	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	15954900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	35264566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	17170365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	18403391, 18757851, 19222470, 20141580, 24051141, 26908601, 35264566, 37308506	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thromboembolism	Venous thromboembolism	Pubtator	35264566	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Venous thrombosis	Pubtator	15304035, 18403391, 20141580, 21980494, 22443383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PROCR (protein C receptor)