Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	10541
Gene name	Acidic nuclear phosphoprotein 32 family member B
Gene symbol	ANP32B
Synonyms (NCBI Gene)	APRILPHAPI2SSP29
Chromosome	9
Chromosome location	9q22.33

528

Show/Hide all (528)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001390	hsa-miR-1-3p	pSILAC	18668040
MIRT001390	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT044574	hsa-miR-320a	CLASH	23622248
MIRT041280	hsa-miR-193b-3p	CLASH	23622248
MIRT037041	hsa-miR-877-3p	CLASH	23622248
MIRT037041	hsa-miR-877-3p	CLASH	23622248
MIRT705652	hsa-miR-9-5p	HITS-CLIP	23313552
MIRT705651	hsa-miR-760	HITS-CLIP	23313552
MIRT705650	hsa-miR-873-5p	HITS-CLIP	23313552
MIRT001390	hsa-miR-1-3p	HITS-CLIP	23313552
MIRT364223	hsa-miR-613	HITS-CLIP	23313552
MIRT364222	hsa-miR-206	HITS-CLIP	23313552
MIRT705649	hsa-miR-513b-3p	HITS-CLIP	23313552
MIRT364225	hsa-miR-4476	HITS-CLIP	23313552
MIRT364227	hsa-miR-6876-5p	HITS-CLIP	23313552
MIRT705648	hsa-miR-26a-1-3p	HITS-CLIP	23313552
MIRT705647	hsa-miR-26a-2-3p	HITS-CLIP	23313552
MIRT705646	hsa-miR-6822-3p	HITS-CLIP	23313552
MIRT705645	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT705644	hsa-miR-6745	HITS-CLIP	23313552
MIRT705643	hsa-miR-6756-5p	HITS-CLIP	23313552
MIRT705642	hsa-miR-6766-5p	HITS-CLIP	23313552
MIRT705641	hsa-miR-1293	HITS-CLIP	23313552
MIRT705640	hsa-miR-4483	HITS-CLIP	23313552
MIRT705639	hsa-miR-6769a-5p	HITS-CLIP	23313552
MIRT705638	hsa-miR-6769b-5p	HITS-CLIP	23313552
MIRT705637	hsa-miR-513a-5p	HITS-CLIP	23313552
MIRT705636	hsa-miR-6844	HITS-CLIP	23313552
MIRT705635	hsa-miR-8057	HITS-CLIP	23313552
MIRT705634	hsa-miR-1262	HITS-CLIP	23313552
MIRT705633	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT705632	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT705631	hsa-miR-6741-5p	HITS-CLIP	23313552
MIRT512293	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT226733	hsa-miR-548ab	PAR-CLIP	20371350
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT226736	hsa-miR-548ak	PAR-CLIP	20371350
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT226728	hsa-miR-548i	PAR-CLIP	20371350
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT226729	hsa-miR-548w	PAR-CLIP	20371350
MIRT226731	hsa-miR-548y	PAR-CLIP	20371350
MIRT226721	hsa-miR-559	PAR-CLIP	20371350
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT512290	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT226720	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT226719	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT512293	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT226733	hsa-miR-548ab	PAR-CLIP	20371350
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT226736	hsa-miR-548ak	PAR-CLIP	20371350
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT226728	hsa-miR-548i	PAR-CLIP	20371350
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT226729	hsa-miR-548w	PAR-CLIP	20371350
MIRT226731	hsa-miR-548y	PAR-CLIP	20371350
MIRT226721	hsa-miR-559	PAR-CLIP	20371350
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT512290	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT226720	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT226719	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT512293	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT226733	hsa-miR-548ab	PAR-CLIP	23446348
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT226736	hsa-miR-548ak	PAR-CLIP	23446348
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT226728	hsa-miR-548i	PAR-CLIP	23446348
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT226729	hsa-miR-548w	PAR-CLIP	23446348
MIRT226731	hsa-miR-548y	PAR-CLIP	23446348
MIRT226721	hsa-miR-559	PAR-CLIP	23446348
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	23446348
MIRT512290	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT226720	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT226719	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT512293	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT226733	hsa-miR-548ab	PAR-CLIP	23446348
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT226736	hsa-miR-548ak	PAR-CLIP	23446348
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT226728	hsa-miR-548i	PAR-CLIP	23446348
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT226729	hsa-miR-548w	PAR-CLIP	23446348
MIRT226731	hsa-miR-548y	PAR-CLIP	23446348
MIRT226721	hsa-miR-559	PAR-CLIP	23446348
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	23446348
MIRT512290	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT226720	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT226719	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT443458	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT364234	hsa-miR-3163	PAR-CLIP	22100165
MIRT705652	hsa-miR-9-5p	HITS-CLIP	23313552
MIRT705651	hsa-miR-760	HITS-CLIP	23313552
MIRT705650	hsa-miR-873-5p	HITS-CLIP	23313552
MIRT001390	hsa-miR-1-3p	HITS-CLIP	23313552
MIRT364223	hsa-miR-613	HITS-CLIP	23313552
MIRT364222	hsa-miR-206	HITS-CLIP	23313552
MIRT705649	hsa-miR-513b-3p	HITS-CLIP	23313552
MIRT364225	hsa-miR-4476	HITS-CLIP	23313552
MIRT364227	hsa-miR-6876-5p	HITS-CLIP	23313552
MIRT705648	hsa-miR-26a-1-3p	HITS-CLIP	23313552
MIRT705647	hsa-miR-26a-2-3p	HITS-CLIP	23313552
MIRT705646	hsa-miR-6822-3p	HITS-CLIP	23313552
MIRT705645	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT705644	hsa-miR-6745	HITS-CLIP	23313552
MIRT705643	hsa-miR-6756-5p	HITS-CLIP	23313552
MIRT705642	hsa-miR-6766-5p	HITS-CLIP	23313552
MIRT705641	hsa-miR-1293	HITS-CLIP	23313552
MIRT705640	hsa-miR-4483	HITS-CLIP	23313552
MIRT705639	hsa-miR-6769a-5p	HITS-CLIP	23313552
MIRT705638	hsa-miR-6769b-5p	HITS-CLIP	23313552
MIRT705637	hsa-miR-513a-5p	HITS-CLIP	23313552
MIRT705636	hsa-miR-6844	HITS-CLIP	23313552
MIRT705635	hsa-miR-8057	HITS-CLIP	23313552
MIRT705634	hsa-miR-1262	HITS-CLIP	23313552
MIRT705633	hsa-miR-4701-3p	HITS-CLIP	23313552
MIRT705632	hsa-miR-6736-5p	HITS-CLIP	23313552
MIRT705631	hsa-miR-6741-5p	HITS-CLIP	23313552
MIRT512293	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT226733	hsa-miR-548ab	PAR-CLIP	20371350
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT226736	hsa-miR-548ak	PAR-CLIP	20371350
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT226728	hsa-miR-548i	PAR-CLIP	20371350
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT226729	hsa-miR-548w	PAR-CLIP	20371350
MIRT226731	hsa-miR-548y	PAR-CLIP	20371350
MIRT226721	hsa-miR-559	PAR-CLIP	20371350
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT512290	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT226720	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT226719	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT512293	hsa-miR-493-5p	PAR-CLIP	20371350
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	20371350
MIRT226733	hsa-miR-548ab	PAR-CLIP	20371350
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	20371350
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	20371350
MIRT226736	hsa-miR-548ak	PAR-CLIP	20371350
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	20371350
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	20371350
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	20371350
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	20371350
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	20371350
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	20371350
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	20371350
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	20371350
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	20371350
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	20371350
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	20371350
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	20371350
MIRT226728	hsa-miR-548i	PAR-CLIP	20371350
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	20371350
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	20371350
MIRT226729	hsa-miR-548w	PAR-CLIP	20371350
MIRT226731	hsa-miR-548y	PAR-CLIP	20371350
MIRT226721	hsa-miR-559	PAR-CLIP	20371350
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	20371350
MIRT512290	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	20371350
MIRT226720	hsa-let-7g-3p	PAR-CLIP	20371350
MIRT226719	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT512293	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT226733	hsa-miR-548ab	PAR-CLIP	23446348
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT226736	hsa-miR-548ak	PAR-CLIP	23446348
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT226728	hsa-miR-548i	PAR-CLIP	23446348
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT226729	hsa-miR-548w	PAR-CLIP	23446348
MIRT226731	hsa-miR-548y	PAR-CLIP	23446348
MIRT226721	hsa-miR-559	PAR-CLIP	23446348
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	23446348
MIRT512290	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT226720	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT226719	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT512293	hsa-miR-493-5p	PAR-CLIP	23446348
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT226723	hsa-miR-548a-5p	PAR-CLIP	23446348
MIRT226733	hsa-miR-548ab	PAR-CLIP	23446348
MIRT226734	hsa-miR-548ad-5p	PAR-CLIP	23446348
MIRT226735	hsa-miR-548ae-5p	PAR-CLIP	23446348
MIRT226736	hsa-miR-548ak	PAR-CLIP	23446348
MIRT226737	hsa-miR-548am-5p	PAR-CLIP	23446348
MIRT226738	hsa-miR-548ap-5p	PAR-CLIP	23446348
MIRT226739	hsa-miR-548aq-5p	PAR-CLIP	23446348
MIRT226740	hsa-miR-548ar-5p	PAR-CLIP	23446348
MIRT226741	hsa-miR-548as-5p	PAR-CLIP	23446348
MIRT226742	hsa-miR-548au-5p	PAR-CLIP	23446348
MIRT226743	hsa-miR-548ay-5p	PAR-CLIP	23446348
MIRT226722	hsa-miR-548b-5p	PAR-CLIP	23446348
MIRT226744	hsa-miR-548bb-5p	PAR-CLIP	23446348
MIRT226724	hsa-miR-548c-5p	PAR-CLIP	23446348
MIRT226725	hsa-miR-548d-5p	PAR-CLIP	23446348
MIRT226727	hsa-miR-548h-5p	PAR-CLIP	23446348
MIRT226728	hsa-miR-548i	PAR-CLIP	23446348
MIRT226726	hsa-miR-548j-5p	PAR-CLIP	23446348
MIRT226732	hsa-miR-548o-5p	PAR-CLIP	23446348
MIRT226729	hsa-miR-548w	PAR-CLIP	23446348
MIRT226731	hsa-miR-548y	PAR-CLIP	23446348
MIRT226721	hsa-miR-559	PAR-CLIP	23446348
MIRT512292	hsa-miR-208a-5p	PAR-CLIP	23446348
MIRT512291	hsa-miR-208b-5p	PAR-CLIP	23446348
MIRT226730	hsa-miR-3613-5p	PAR-CLIP	23446348
MIRT512290	hsa-let-7c-3p	PAR-CLIP	23446348
MIRT226718	hsa-let-7a-2-3p	PAR-CLIP	23446348
MIRT226720	hsa-let-7g-3p	PAR-CLIP	23446348
MIRT226719	hsa-miR-129-5p	PAR-CLIP	23446348
MIRT443459	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT443458	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT364234	hsa-miR-3163	PAR-CLIP	22100165
MIRT785966	hsa-miR-1	CLIP-seq
MIRT785967	hsa-miR-1252	CLIP-seq
MIRT785968	hsa-miR-1271	CLIP-seq
MIRT785969	hsa-miR-1283	CLIP-seq
MIRT785970	hsa-miR-182	CLIP-seq
MIRT785971	hsa-miR-200b	CLIP-seq
MIRT785972	hsa-miR-200c	CLIP-seq
MIRT785973	hsa-miR-216a	CLIP-seq
MIRT785974	hsa-miR-3120-3p	CLIP-seq
MIRT785975	hsa-miR-3126-5p	CLIP-seq
MIRT785976	hsa-miR-3202	CLIP-seq
MIRT785977	hsa-miR-323-5p	CLIP-seq
MIRT785978	hsa-miR-323b-3p	CLIP-seq
MIRT785979	hsa-miR-34a	CLIP-seq
MIRT785980	hsa-miR-34c-5p	CLIP-seq
MIRT785981	hsa-miR-3529	CLIP-seq
MIRT785982	hsa-miR-3662	CLIP-seq
MIRT785983	hsa-miR-379	CLIP-seq
MIRT785984	hsa-miR-3941	CLIP-seq
MIRT785985	hsa-miR-4264	CLIP-seq
MIRT785986	hsa-miR-4274	CLIP-seq
MIRT785987	hsa-miR-429	CLIP-seq
MIRT785988	hsa-miR-4302	CLIP-seq
MIRT785989	hsa-miR-4451	CLIP-seq
MIRT785990	hsa-miR-4453	CLIP-seq
MIRT785991	hsa-miR-4468	CLIP-seq
MIRT785992	hsa-miR-449a	CLIP-seq
MIRT785993	hsa-miR-449b	CLIP-seq
MIRT785994	hsa-miR-451b	CLIP-seq
MIRT785995	hsa-miR-452	CLIP-seq
MIRT785996	hsa-miR-4533	CLIP-seq
MIRT785997	hsa-miR-4536	CLIP-seq
MIRT785998	hsa-miR-4538	CLIP-seq
MIRT785999	hsa-miR-455-3p	CLIP-seq
MIRT786000	hsa-miR-4650-3p	CLIP-seq
MIRT786001	hsa-miR-466	CLIP-seq
MIRT786002	hsa-miR-4668-3p	CLIP-seq
MIRT786003	hsa-miR-4672	CLIP-seq
MIRT786004	hsa-miR-4676-3p	CLIP-seq
MIRT786005	hsa-miR-4698	CLIP-seq
MIRT786006	hsa-miR-4699-3p	CLIP-seq
MIRT786007	hsa-miR-4705	CLIP-seq
MIRT786008	hsa-miR-4724-5p	CLIP-seq
MIRT786009	hsa-miR-4731-3p	CLIP-seq
MIRT786010	hsa-miR-4790-5p	CLIP-seq
MIRT786011	hsa-miR-4797-3p	CLIP-seq
MIRT786012	hsa-miR-4801	CLIP-seq
MIRT786013	hsa-miR-4802-3p	CLIP-seq
MIRT786014	hsa-miR-520d-5p	CLIP-seq
MIRT786015	hsa-miR-524-5p	CLIP-seq
MIRT786016	hsa-miR-548ac	CLIP-seq
MIRT786017	hsa-miR-548d-3p	CLIP-seq
MIRT786018	hsa-miR-548h	CLIP-seq
MIRT786019	hsa-miR-548j	CLIP-seq
MIRT786020	hsa-miR-548v	CLIP-seq
MIRT786021	hsa-miR-548z	CLIP-seq
MIRT786022	hsa-miR-563	CLIP-seq
MIRT786023	hsa-miR-582-3p	CLIP-seq
MIRT786024	hsa-miR-600	CLIP-seq
MIRT786025	hsa-miR-676	CLIP-seq
MIRT786026	hsa-miR-873	CLIP-seq
MIRT786027	hsa-miR-876-3p	CLIP-seq
MIRT786028	hsa-miR-9	CLIP-seq
MIRT786029	hsa-miR-96	CLIP-seq
MIRT1545406	hsa-miR-1343	CLIP-seq
MIRT1545407	hsa-miR-4455	CLIP-seq
MIRT1545408	hsa-miR-609	CLIP-seq
MIRT786028	hsa-miR-9	CLIP-seq
MIRT785973	hsa-miR-216a	CLIP-seq
MIRT785985	hsa-miR-4264	CLIP-seq
MIRT785988	hsa-miR-4302	CLIP-seq
MIRT786011	hsa-miR-4797-3p	CLIP-seq
MIRT786023	hsa-miR-582-3p	CLIP-seq
MIRT785966	hsa-miR-1	CLIP-seq
MIRT1545406	hsa-miR-1343	CLIP-seq
MIRT785974	hsa-miR-3120-3p	CLIP-seq
MIRT1931880	hsa-miR-3147	CLIP-seq
MIRT785977	hsa-miR-323-5p	CLIP-seq
MIRT1931881	hsa-miR-342-5p	CLIP-seq
MIRT785981	hsa-miR-3529	CLIP-seq
MIRT785983	hsa-miR-379	CLIP-seq
MIRT785984	hsa-miR-3941	CLIP-seq
MIRT1931882	hsa-miR-4425	CLIP-seq
MIRT785989	hsa-miR-4451	CLIP-seq
MIRT785990	hsa-miR-4453	CLIP-seq
MIRT1545407	hsa-miR-4455	CLIP-seq
MIRT785994	hsa-miR-451b	CLIP-seq
MIRT785997	hsa-miR-4536	CLIP-seq
MIRT785998	hsa-miR-4538	CLIP-seq
MIRT786000	hsa-miR-4650-3p	CLIP-seq
MIRT1931883	hsa-miR-4651	CLIP-seq
MIRT786001	hsa-miR-466	CLIP-seq
MIRT1931884	hsa-miR-4664-5p	CLIP-seq
MIRT786003	hsa-miR-4672	CLIP-seq
MIRT786007	hsa-miR-4705	CLIP-seq
MIRT786009	hsa-miR-4731-3p	CLIP-seq
MIRT786012	hsa-miR-4801	CLIP-seq
MIRT786016	hsa-miR-548ac	CLIP-seq
MIRT786017	hsa-miR-548d-3p	CLIP-seq
MIRT786020	hsa-miR-548v	CLIP-seq
MIRT786021	hsa-miR-548z	CLIP-seq
MIRT786022	hsa-miR-563	CLIP-seq
MIRT786023	hsa-miR-582-3p	CLIP-seq
MIRT786024	hsa-miR-600	CLIP-seq
MIRT1931885	hsa-miR-608	CLIP-seq
MIRT1545408	hsa-miR-609	CLIP-seq
MIRT786026	hsa-miR-873	CLIP-seq
MIRT786027	hsa-miR-876-3p	CLIP-seq
MIRT786028	hsa-miR-9	CLIP-seq
MIRT785969	hsa-miR-1283	CLIP-seq
MIRT1545406	hsa-miR-1343	CLIP-seq
MIRT785973	hsa-miR-216a	CLIP-seq
MIRT1931880	hsa-miR-3147	CLIP-seq
MIRT785977	hsa-miR-323-5p	CLIP-seq
MIRT1931881	hsa-miR-342-5p	CLIP-seq
MIRT785981	hsa-miR-3529	CLIP-seq
MIRT785983	hsa-miR-379	CLIP-seq
MIRT785984	hsa-miR-3941	CLIP-seq
MIRT785985	hsa-miR-4264	CLIP-seq
MIRT785986	hsa-miR-4274	CLIP-seq
MIRT785988	hsa-miR-4302	CLIP-seq
MIRT1931882	hsa-miR-4425	CLIP-seq
MIRT785989	hsa-miR-4451	CLIP-seq
MIRT785990	hsa-miR-4453	CLIP-seq
MIRT1545407	hsa-miR-4455	CLIP-seq
MIRT785991	hsa-miR-4468	CLIP-seq
MIRT785997	hsa-miR-4536	CLIP-seq
MIRT785998	hsa-miR-4538	CLIP-seq
MIRT785999	hsa-miR-455-3p	CLIP-seq
MIRT786000	hsa-miR-4650-3p	CLIP-seq
MIRT1931883	hsa-miR-4651	CLIP-seq
MIRT786001	hsa-miR-466	CLIP-seq
MIRT1931884	hsa-miR-4664-5p	CLIP-seq
MIRT786002	hsa-miR-4668-3p	CLIP-seq
MIRT786003	hsa-miR-4672	CLIP-seq
MIRT786009	hsa-miR-4731-3p	CLIP-seq
MIRT786011	hsa-miR-4797-3p	CLIP-seq
MIRT786012	hsa-miR-4801	CLIP-seq
MIRT786016	hsa-miR-548ac	CLIP-seq
MIRT786017	hsa-miR-548d-3p	CLIP-seq
MIRT786018	hsa-miR-548h	CLIP-seq
MIRT786019	hsa-miR-548j	CLIP-seq
MIRT786021	hsa-miR-548z	CLIP-seq
MIRT786022	hsa-miR-563	CLIP-seq
MIRT786023	hsa-miR-582-3p	CLIP-seq
MIRT1931885	hsa-miR-608	CLIP-seq
MIRT1545408	hsa-miR-609	CLIP-seq
MIRT786026	hsa-miR-873	CLIP-seq
MIRT786027	hsa-miR-876-3p	CLIP-seq
MIRT786028	hsa-miR-9	CLIP-seq
MIRT786028	hsa-miR-9	CLIP-seq
MIRT1545406	hsa-miR-1343	CLIP-seq
MIRT1931880	hsa-miR-3147	CLIP-seq
MIRT785977	hsa-miR-323-5p	CLIP-seq
MIRT1931881	hsa-miR-342-5p	CLIP-seq
MIRT785981	hsa-miR-3529	CLIP-seq
MIRT785983	hsa-miR-379	CLIP-seq
MIRT785984	hsa-miR-3941	CLIP-seq
MIRT1931882	hsa-miR-4425	CLIP-seq
MIRT785989	hsa-miR-4451	CLIP-seq
MIRT785990	hsa-miR-4453	CLIP-seq
MIRT1545407	hsa-miR-4455	CLIP-seq
MIRT785997	hsa-miR-4536	CLIP-seq
MIRT785998	hsa-miR-4538	CLIP-seq
MIRT786000	hsa-miR-4650-3p	CLIP-seq
MIRT1931883	hsa-miR-4651	CLIP-seq
MIRT786001	hsa-miR-466	CLIP-seq
MIRT1931884	hsa-miR-4664-5p	CLIP-seq
MIRT786003	hsa-miR-4672	CLIP-seq
MIRT786009	hsa-miR-4731-3p	CLIP-seq
MIRT786012	hsa-miR-4801	CLIP-seq
MIRT786016	hsa-miR-548ac	CLIP-seq
MIRT786017	hsa-miR-548d-3p	CLIP-seq
MIRT786021	hsa-miR-548z	CLIP-seq
MIRT1931885	hsa-miR-608	CLIP-seq
MIRT1545408	hsa-miR-609	CLIP-seq
MIRT786026	hsa-miR-873	CLIP-seq
MIRT786027	hsa-miR-876-3p	CLIP-seq
MIRT786028	hsa-miR-9	CLIP-seq
MIRT1931880	hsa-miR-3147	CLIP-seq
MIRT785977	hsa-miR-323-5p	CLIP-seq
MIRT1931881	hsa-miR-342-5p	CLIP-seq
MIRT785981	hsa-miR-3529	CLIP-seq
MIRT785983	hsa-miR-379	CLIP-seq
MIRT785984	hsa-miR-3941	CLIP-seq
MIRT1931882	hsa-miR-4425	CLIP-seq
MIRT785989	hsa-miR-4451	CLIP-seq
MIRT785990	hsa-miR-4453	CLIP-seq
MIRT1545407	hsa-miR-4455	CLIP-seq
MIRT785997	hsa-miR-4536	CLIP-seq
MIRT785998	hsa-miR-4538	CLIP-seq
MIRT786000	hsa-miR-4650-3p	CLIP-seq
MIRT1931883	hsa-miR-4651	CLIP-seq
MIRT786001	hsa-miR-466	CLIP-seq
MIRT1931884	hsa-miR-4664-5p	CLIP-seq
MIRT786003	hsa-miR-4672	CLIP-seq
MIRT786009	hsa-miR-4731-3p	CLIP-seq
MIRT786012	hsa-miR-4801	CLIP-seq
MIRT786016	hsa-miR-548ac	CLIP-seq
MIRT786017	hsa-miR-548d-3p	CLIP-seq
MIRT786021	hsa-miR-548z	CLIP-seq
MIRT1931885	hsa-miR-608	CLIP-seq
MIRT1545408	hsa-miR-609	CLIP-seq
MIRT786026	hsa-miR-873	CLIP-seq
MIRT786027	hsa-miR-876-3p	CLIP-seq
MIRT786028	hsa-miR-9	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001944	Process	Vasculature development	IEA
GO:0005515	Function	Protein binding	IPI	21988832, 25416956, 31515488, 32296183, 32814053, 35271311
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9285060, 17178712
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA	9285060
GO:0005737	Component	Cytoplasm	IDA	17178712
GO:0005737	Component	Cytoplasm	IEA
GO:0006334	Process	Nucleosome assembly	IDA	20538007
GO:0021591	Process	Ventricular system development	IEA
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	20538007
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	20015864
GO:0045596	Process	Negative regulation of cell differentiation	IDA	22705300
GO:0046827	Process	Positive regulation of protein export from nucleus	IMP	17178712
GO:0048839	Process	Inner ear development	IEA
GO:0060021	Process	Roof of mouth development	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070063	Function	RNA polymerase binding	IDA	9285060

MIM	HGNC	e!Ensembl
619823	16677	ENSG00000136938

Q92688

Protein name

Acidic leucine-rich nuclear phosphoprotein 32 family member B (Acidic protein rich in leucines) (Putative HLA-DR-associated protein I-2) (PHAPI2) (Silver-stainable protein SSP29)

Protein function

Multifunctional protein that is involved in the regulation of many processes including cell proliferation, apoptosis, cell cycle progression or transcription (PubMed:18039846, PubMed:20015864). Regulates the proliferation of neuronal stem cells,

PDB

2ELL , 2RR6 , 8R1J , 8R1L

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12799	LRR_4	88 → 133	Leucine Rich repeats (2 copies)	Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, lung, pancreas, prostate and in spleen, thymus and placenta. {ECO:0000269|PubMed:9473664}.

Sequence

MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
PKLPKLKKLELSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDL
FNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDE
DDEDGEEEEFDEEDDEDEDVEGDEDDDEVSEEEEEFGLDEEDEDEDEDEEEEEGGKGEKR
KRETDDEGEDD

Sequence length

251

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (80)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	17556024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29697578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28062797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	20003335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16960154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31231554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21765951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12370363, 15070697, 15308519, 18295728, 20890272, 30890743		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19291294, 23775715		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	14504101, 19395025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31161935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21636789, 25750171, 29904116, 30131941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28486557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35280441	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19997650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14504101, 15488762, 15580304, 19395025, 24100449, 24245956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19466596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22705846, 24771268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	17556024, 24809296, 24827633, 28651547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21483105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19806256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19806256		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	19806256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21798884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21765951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27923834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	27098405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	14691452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	14691452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	28267197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	22627727, 24555783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	19291294, 25750171, 29310835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	16960154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	29516280		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	27920152, 28636766, 29312588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29310835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	19824872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27986304, 28323891		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24100449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29310835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18460811, 28035399, 28486557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	18460811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28267197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28267197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12730512, 15308519, 17307753, 17569747, 21984075, 23171638, 26424128, 27390168, 27878683, 28215100, 28267197, 29783918, 30467093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	20890272, 23171638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28267197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30458319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21636789, 25750171, 29904116, 30131941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18575728, 30011858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25612651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19291294, 22705846, 22923013, 24771268, 25750171, 27923834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25750171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	29423047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	20890394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	20945608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17550853, 20890394, 25753925, 28928810, 30135465, 31698455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16087247, 24832354, 30635946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	19806256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	29516280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11550092, 12202623, 15070697, 15488762, 15846369, 19291294, 20003335, 20890394, 24771268, 25750171, 27923834, 9743536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29312608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongranulomatous uveitis	Nongranulomatous uveitis	BEFREE	31161935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	26150532, 28013554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18575728, 30011858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	26150532, 28013554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29697578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	31615554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21483105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16239971, 17307753, 17968879, 21798884, 27372914, 28215100, 30941763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	31161935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	BEFREE	21765951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	28651547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29781374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	22166983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22166983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25612651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	29998368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33903625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	19291294		★★★★★ ★☆☆☆☆ Found in Text Mining only

ANP32B (acidic nuclear phosphoprotein 32 family member B)