GLRX3 (glutaredoxin 3)

Gene

• Entrez ID: 10539
• Gene name: Glutaredoxin 3
• Gene symbol: GLRX3
• Synonyms (NCBI Gene): GLRX4, GRX3, GRX4, PICOT, TXNL2, TXNL3
• Chromosome: 10
• Chromosome location: 10q26.3
• Summary: This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The enc

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028654	hsa-miR-30a-5p	Proteomics	18668040
MIRT1021444	hsa-miR-1224-5p	CLIP-seq
MIRT1021445	hsa-miR-150	CLIP-seq
MIRT1021446	hsa-miR-3545-3p	CLIP-seq
MIRT1021447	hsa-miR-380	CLIP-seq
MIRT1021448	hsa-miR-384	CLIP-seq
MIRT1021449	hsa-miR-4303	CLIP-seq
MIRT1021450	hsa-miR-4649-3p	CLIP-seq
MIRT1021451	hsa-miR-4751	CLIP-seq
MIRT1021452	hsa-miR-4759	CLIP-seq
MIRT1021453	hsa-miR-4762-3p	CLIP-seq
MIRT1021454	hsa-miR-554	CLIP-seq
MIRT2235655	hsa-miR-1827	CLIP-seq
MIRT2235656	hsa-miR-3929	CLIP-seq
MIRT2235657	hsa-miR-4419b	CLIP-seq
MIRT2235658	hsa-miR-4478	CLIP-seq
MIRT1021450	hsa-miR-4649-3p	CLIP-seq
MIRT2539584	hsa-miR-3122	CLIP-seq
MIRT2539585	hsa-miR-338-3p	CLIP-seq
MIRT2539586	hsa-miR-3607-3p	CLIP-seq
MIRT2539587	hsa-miR-3689a-3p	CLIP-seq
MIRT2539588	hsa-miR-3689c	CLIP-seq
MIRT2539589	hsa-miR-3913-5p	CLIP-seq
MIRT2539590	hsa-miR-4530	CLIP-seq
MIRT2539591	hsa-miR-4728-5p	CLIP-seq
MIRT2539584	hsa-miR-3122	CLIP-seq
MIRT2539585	hsa-miR-338-3p	CLIP-seq
MIRT2539586	hsa-miR-3607-3p	CLIP-seq
MIRT2539587	hsa-miR-3689a-3p	CLIP-seq
MIRT2539588	hsa-miR-3689c	CLIP-seq
MIRT2539589	hsa-miR-3913-5p	CLIP-seq
MIRT2681662	hsa-miR-4281	CLIP-seq
MIRT2539590	hsa-miR-4530	CLIP-seq
MIRT2539591	hsa-miR-4728-5p	CLIP-seq
MIRT2681663	hsa-miR-510	CLIP-seq
MIRT2681664	hsa-miR-512-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002026	Process	Regulation of the force of heart contraction	ISS	18258855
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005515	Function	Protein binding	IPI	10636891, 15846844, 16189514, 21516116, 25416956, 25910212, 26302480, 26871637, 27107012, 27519415, 28514442, 29892012, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	NAS	32910989
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	32910989
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IBA
GO:0006879	Process	Intracellular iron ion homeostasis	IDA	27519415
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	ISS
GO:0016226	Process	Iron-sulfur cluster assembly	IDA	27519415
GO:0030018	Component	Z disc	IEA
GO:0030425	Component	Dendrite	IEA
GO:0042802	Function	Identical protein binding	IPI	25416956, 26302480, 27519415
GO:0044571	Process	[2Fe-2S] cluster assembly	IDA	27519415
GO:0045454	Process	Cell redox homeostasis	IDA	27519415
GO:0046872	Function	Metal ion binding	IEA
GO:0051536	Function	Iron-sulfur cluster binding	IEA
GO:1990229	Component	Iron-sulfur cluster assembly complex	IPI	22309771

Other IDs

• MIM: 612754
• HGNC: 15987
• e!Ensembl: ENSG00000108010

Protein

• UniProt ID: O76003
• Protein name: Glutaredoxin-3 (PKC-interacting cousin of thioredoxin) (PICOT) (PKC-theta-interacting protein) (PKCq-interacting protein) (Thioredoxin-like protein 2)
• Protein function: Together with BOLA2, acts as a cytosolic iron-sulfur (Fe-S) cluster assembly factor that facilitates [2Fe-2S] cluster insertion into a subset of cytosolic proteins (PubMed:26613676, PubMed:27519415). Acts as a critical negative regulator of card
• PDB: 2DIY, 2WZ9, 2YAN, 3ZYW
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00085	Thioredoxin	13 → 114	Thioredoxin	Domain
  PF00462	Glutaredoxin	146 → 210	Glutaredoxin	Domain
  PF00462	Glutaredoxin	248 → 312	Glutaredoxin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in heart, spleen, testis and, to a lower extent, in thymus and peripheral blood leukocytes. Weakly expressed in lung, placenta, colon and small intestine.
• Sequence:

  MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKEL
  PQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGS
  FLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFD
  IFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLK
  VLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWP
  TYPQLYVKGELVGGLDIVKELKENGELLPILRGEN

• Sequence length: 335

Pathways

Reactome:

Iron uptake and transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	31527584		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	20170406		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36071684	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21123948, 27894063		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25004829, 36017386	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19797004		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	36071684	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23311631		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25004829		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18528843		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28439594		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	20170406		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21123948		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25004829		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21123948, 27894063		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19797004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19797004		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19797004, 23311631, 29317492, 29397791, 30489196, 30661989		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19797004, 23311631		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28439594		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25004829, 31527584		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	39251997	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39251997	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29628988		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30661989		★☆☆☆☆ Found in Text Mining only