Gene Gene information from NCBI Gene database.
Entrez ID 105371045
Gene name Proline and glutamate rich with coiled coil 1
Gene symbol PERCC1
Synonyms (NCBI Gene)
DIAR11ICRgs104
Chromosome 16
Chromosome location 16p13.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0035883 Process Enteroendocrine cell differentiation IEA
GO:0035883 Process Enteroendocrine cell differentiation ISS
GO:0048546 Process Digestive tract morphogenesis IEA
GO:0048546 Process Digestive tract morphogenesis ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618656 52293 ENSG00000284395
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A1W2PR82
Protein name Protein PERCC1 (Proline and glutamage-rich protein with a coiled coil domain)
Protein function Plays a critical role in intestinal function (PubMed:31217582). Acts by promoting the development of enteroendocrine cells (EECs) of the gastrointestinal tract and pancreas (By similarity). It is thereby required for normal enteroendocrine pepti
Family and domains
Sequence
MAAGVIRPLCDFQLPLLRHHPFLPSDPEPPETSEEEEEEEEEEEEEEGEGEGLGGCGRIL
PSSGRAEATEEAAPEGPGSPETPLQLLRFSELISDDIRRYFGRKDKGQDPDACDVYADSR
PPRSTARELYYADLVRLARGGSLEDEDTPEPRVPQGQVCRPGLSGDRAQPLGPLAELFDY
GLQQYWGSRAAAGWSLTLERKYGHITPMAQRKLPPSFWKEPTPSPLGLLHPGTPDFSDLL
ASWSTEACPELPGRGTPALEGARPAEA
Sequence length 267
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Diarrhea 11, malabsorptive, congenital Likely pathogenic rs1447499380 RCV003333649
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGENITAL EPITHELIAL DYSPLASIA OF INTESTINE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute bronchitis Bronchitis BEFREE 26930562
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 29408852
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 12102470
★☆☆☆☆
Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor Teratoid Rhabdoid Tumor BEFREE 31118350
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorders Autism Spectrum Disorder BEFREE 28711654
★☆☆☆☆
Found in Text Mining only
Beckwith-Wiedemann Syndrome Beckwith-Wiedemann Syndrome BEFREE 24990148
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 1346789, 1460508
★☆☆☆☆
Found in Text Mining only
Buruli Ulcer Buruli Ulcer BEFREE 28329001
★☆☆☆☆
Found in Text Mining only
Cataract Cataract BEFREE 10726880
★☆☆☆☆
Found in Text Mining only
Cerebral Infarction Cerebral Infarction BEFREE 29948728
★☆☆☆☆
Found in Text Mining only