UBD (ubiquitin like modifier D)

Gene

• Entrez ID: 10537
• Gene name: Ubiquitin like modifier D
• Gene symbol: UBD
• Synonyms (NCBI Gene): FAT10, UBD-3
• Chromosome: 6
• Chromosome location: 6p22.1
• Summary: This gene encodes a protein which contains two ubiquitin-like domains and appears to have similar function to ubiquitin. Through covalent attachment, the encoded protein targets other proteins for 26S proteasome degradation. This protein has been implicat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017438	hsa-miR-335-5p	Microarray	18185580
MIRT030468	hsa-miR-24-3p	qRT-PCR;Microarray	19748357
MIRT713487	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT713485	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT713484	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT713483	hsa-miR-6748-3p	HITS-CLIP	19536157
MIRT713481	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT713482	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT713480	hsa-miR-214-5p	HITS-CLIP	19536157
MIRT713479	hsa-miR-6735-3p	HITS-CLIP	19536157
MIRT713478	hsa-miR-3909	HITS-CLIP	19536157
MIRT713477	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT713475	hsa-miR-7848-3p	HITS-CLIP	19536157
MIRT713476	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT709758	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT709757	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT709756	hsa-miR-6801-3p	HITS-CLIP	19536157
MIRT709755	hsa-miR-6810-3p	HITS-CLIP	19536157
MIRT709754	hsa-miR-331-3p	HITS-CLIP	19536157
MIRT709753	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT709752	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT709751	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT709750	hsa-miR-4469	HITS-CLIP	19536157
MIRT709749	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT709748	hsa-miR-4287	HITS-CLIP	19536157
MIRT709747	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT709746	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT709745	hsa-miR-938	HITS-CLIP	19536157
MIRT709744	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT709743	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT709742	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT713487	hsa-miR-6865-3p	HITS-CLIP	19536157
MIRT713485	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT713484	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT713483	hsa-miR-6748-3p	HITS-CLIP	19536157
MIRT713481	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT713482	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT713480	hsa-miR-214-5p	HITS-CLIP	19536157
MIRT713479	hsa-miR-6735-3p	HITS-CLIP	19536157
MIRT713478	hsa-miR-3909	HITS-CLIP	19536157
MIRT713477	hsa-miR-6852-3p	HITS-CLIP	19536157
MIRT713475	hsa-miR-7848-3p	HITS-CLIP	19536157
MIRT713476	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT709758	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT709757	hsa-miR-6795-3p	HITS-CLIP	19536157
MIRT709756	hsa-miR-6801-3p	HITS-CLIP	19536157
MIRT709755	hsa-miR-6810-3p	HITS-CLIP	19536157
MIRT709754	hsa-miR-331-3p	HITS-CLIP	19536157
MIRT709753	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT709752	hsa-miR-6752-3p	HITS-CLIP	19536157
MIRT709751	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT709750	hsa-miR-4469	HITS-CLIP	19536157
MIRT709749	hsa-miR-7113-3p	HITS-CLIP	19536157
MIRT709748	hsa-miR-4287	HITS-CLIP	19536157
MIRT709747	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT709746	hsa-miR-18a-3p	HITS-CLIP	19536157
MIRT709745	hsa-miR-938	HITS-CLIP	19536157
MIRT709744	hsa-miR-6886-3p	HITS-CLIP	19536157
MIRT709743	hsa-miR-6826-3p	HITS-CLIP	19536157
MIRT709742	hsa-miR-6867-3p	HITS-CLIP	19536157
MIRT1466923	hsa-miR-3152-5p	CLIP-seq
MIRT1466924	hsa-miR-4774-3p	CLIP-seq
MIRT1466925	hsa-miR-548c-3p	CLIP-seq
MIRT2140326	hsa-miR-3122	CLIP-seq
MIRT2140327	hsa-miR-3153	CLIP-seq
MIRT2140328	hsa-miR-3913-5p	CLIP-seq
MIRT2140329	hsa-miR-4668-5p	CLIP-seq
MIRT2140330	hsa-miR-4775	CLIP-seq
MIRT2140331	hsa-miR-590-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	10200259, 14757770, 16495226, 16707496, 17889673, 19033385, 24528925, 25422469, 25814554, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12730673
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006508	Process	Proteolysis	NAS	9368598
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IBA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	17889673
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0016235	Component	Aggresome	IDA	19033385
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IDA	15831455, 17889673
GO:0016567	Process	Protein ubiquitination	IEA
GO:0032446	Process	Protein modification by small protein conjugation	NAS	9368598
GO:0034341	Process	Response to type II interferon	IBA
GO:0034341	Process	Response to type II interferon	IEA
GO:0034341	Process	Response to type II interferon	IEP	17889673
GO:0034612	Process	Response to tumor necrosis factor	IBA
GO:0034612	Process	Response to tumor necrosis factor	IEA
GO:0034612	Process	Response to tumor necrosis factor	IEP	17889673
GO:0043011	Process	Myeloid dendritic cell differentiation	IMP	19028597
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	16495380
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	19959714
GO:0070628	Function	Proteasome binding	IBA
GO:0070628	Function	Proteasome binding	IDA	16707496
GO:0070628	Function	Proteasome binding	IEA
GO:0070842	Process	Aggresome assembly	IDA	19033385
GO:1901990	Process	Regulation of mitotic cell cycle phase transition	IMP	16495226

Other IDs

• MIM: 606050
• HGNC: 18795
• e!Ensembl: ENSG00000213886

Protein

• UniProt ID: O15205
• Protein name: Ubiquitin D (Diubiquitin) (Ubiquitin-like protein FAT10)
• Protein function: Ubiquitin-like protein modifier which can be covalently attached to target proteins and subsequently leads to their degradation by the 26S proteasome, in a NUB1-dependent manner (PubMed:15831455, PubMed:16707496, PubMed:19166848). Conjugation to
• PDB: 2MBE, 6GF1, 6GF2, 7PYV, 9E8O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00240	ubiquitin	10 → 81	Ubiquitin family	Domain
  PF00240	ubiquitin	91 → 161	Ubiquitin family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Constitutively expressed in mature dendritic cells and B-cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland. {ECO:0000269|PubMed:12730673, ECO:0
• Sequence:

  MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPR
  RSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIE
  TKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG

• Sequence length: 165

Pathways

Reactome:

Neddylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BILIARY CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, ANIMAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, BILIARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CHOLANGITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	21396347		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24492942		★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	33414395	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36660934	Stimulate	★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	30009772		★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	CTD_human_DG	18422935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Biliary Cirrhosis, Primary, 1	Biliary cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	27806337, 29749526		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30361097		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29685151	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	20808312	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18574467		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20433827, 34863035	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35728518	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	27806337, 29749526		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25586346	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	19808075, 30097691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	CTD_human_DG	30097691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	30097691	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29436659	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18574467, 25238407		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21351261, 30984346		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20808312	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20848455		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24996260		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30131712		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30131712		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33902539	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24996260		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	16782901		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30961474	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30009772		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29531077, 30624253		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22402871, 26733179, 27393295, 31729307		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	29531077	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34550272	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	35728518	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21757738		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18776587	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29953254, 30395194		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	30097691	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30395194		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	16495380		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	29531077	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18574467, 18695959, 22292662, 22569823, 23812429, 24440736, 25056121, 29458176, 29790184, 29949944		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18574467		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	19363144		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	34863035	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20808312, 25586346	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24244368	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30361097		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	31729307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19437562		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27806337, 29749526		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18574467, 27393295, 27806337, 31036418, 31729307		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25238407		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	20433827	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28983594		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	37019912	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	23416168		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	33414395	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19437562, 25238407, 26637872, 26733179, 27393295, 27806337, 29458176, 29949944		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis, Type 3, mixed central and peripheral	Neurofibromatosis	BEFREE	26430762		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33902539	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27279480		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30415394		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38136595	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24492942		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	16495380		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	20808312	Associate	★☆☆☆☆ Found in Text Mining only
Secondary Biliary Cholangitis	Biliary Cholangitis	CTD_human_DG	18422935		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19437562		★☆☆☆☆ Found in Text Mining only