ATG7 (autophagy related 7)

Gene

• Entrez ID: 10533
• Gene name: Autophagy related 7
• Gene symbol: ATG7
• Synonyms (NCBI Gene): APG7-LIKE, APG7L, GSA7, SCAR31
• Chromosome: 3
• Chromosome location: 3p25.3
• Summary: This gene encodes an E1-like activating enzyme that is essential for autophagy and cytoplasmic to vacuole transport. The encoded protein is also thought to modulate p53-dependent cell cycle pathways during prolonged metabolic stress. It has been associate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT020034	hsa-miR-375	Microarray	20215506
MIRT036161	hsa-miR-320c	CLASH	23622248
MIRT053396	hsa-miR-96-5p	Microarray	23807165
MIRT497067	hsa-miR-4640-3p	PAR-CLIP	22291592
MIRT494598	hsa-miR-6895-5p	PAR-CLIP	22291592
MIRT497066	hsa-miR-6783-5p	PAR-CLIP	22291592
MIRT494596	hsa-miR-3918	PAR-CLIP	22291592
MIRT497065	hsa-miR-1266-5p	PAR-CLIP	22291592
MIRT497064	hsa-miR-4518	PAR-CLIP	22291592
MIRT497063	hsa-miR-6879-3p	PAR-CLIP	22291592
MIRT497062	hsa-miR-6802-3p	PAR-CLIP	22291592
MIRT497061	hsa-miR-3127-5p	PAR-CLIP	22291592
MIRT495433	hsa-miR-154-5p	PAR-CLIP	23708386
MIRT495432	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT495431	hsa-miR-451b	PAR-CLIP	23708386
MIRT495430	hsa-miR-3922-5p	PAR-CLIP	23708386
MIRT495429	hsa-miR-6826-5p	PAR-CLIP	23708386
MIRT495428	hsa-miR-4708-3p	PAR-CLIP	23708386
MIRT494599	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT494598	hsa-miR-6895-5p	PAR-CLIP	23592263
MIRT494597	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT494596	hsa-miR-3918	PAR-CLIP	23592263
MIRT494595	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT494594	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT494593	hsa-miR-4640-5p	PAR-CLIP	23592263
MIRT494591	hsa-miR-4726-5p	PAR-CLIP	23592263
MIRT494592	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT494590	hsa-miR-4687-5p	PAR-CLIP	23592263
MIRT733227	hsa-miR-129-5p	Immunoprecipitaion (IP), Luciferase reporter assay, RNA-seq, qRT-PCR	33637694
MIRT734335	hsa-miR-542-5p	Luciferase reporter assay, Western blotting	33394350
MIRT735427	hsa-miR-4802-3p	qRT-PCR	33160314
MIRT735533	hsa-miR-20a-5p	Immunofluorescence, Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	32661238
MIRT733227	hsa-miR-129-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31781210
MIRT497067	hsa-miR-4640-3p	PAR-CLIP	22291592
MIRT494598	hsa-miR-6895-5p	PAR-CLIP	22291592
MIRT497066	hsa-miR-6783-5p	PAR-CLIP	22291592
MIRT494596	hsa-miR-3918	PAR-CLIP	22291592
MIRT497065	hsa-miR-1266-5p	PAR-CLIP	22291592
MIRT497064	hsa-miR-4518	PAR-CLIP	22291592
MIRT497063	hsa-miR-6879-3p	PAR-CLIP	22291592
MIRT497062	hsa-miR-6802-3p	PAR-CLIP	22291592
MIRT497061	hsa-miR-3127-5p	PAR-CLIP	22291592
MIRT495433	hsa-miR-154-5p	PAR-CLIP	23708386
MIRT495432	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT495431	hsa-miR-451b	PAR-CLIP	23708386
MIRT495430	hsa-miR-3922-5p	PAR-CLIP	23708386
MIRT495429	hsa-miR-6826-5p	PAR-CLIP	23708386
MIRT495428	hsa-miR-4708-3p	PAR-CLIP	23708386
MIRT494599	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT494598	hsa-miR-6895-5p	PAR-CLIP	23592263
MIRT494597	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT494596	hsa-miR-3918	PAR-CLIP	23592263
MIRT494595	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT494594	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT494593	hsa-miR-4640-5p	PAR-CLIP	23592263
MIRT494591	hsa-miR-4726-5p	PAR-CLIP	23592263
MIRT494592	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT494590	hsa-miR-4687-5p	PAR-CLIP	23592263
MIRT756064	hsa-miR-20b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36090477
MIRT756231	hsa-miR-188-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36846012
MIRT805592	hsa-miR-1250	CLIP-seq
MIRT805593	hsa-miR-1285	CLIP-seq
MIRT805594	hsa-miR-1343	CLIP-seq
MIRT805595	hsa-miR-1915	CLIP-seq
MIRT805596	hsa-miR-193a-3p	CLIP-seq
MIRT805597	hsa-miR-193b	CLIP-seq
MIRT805598	hsa-miR-203	CLIP-seq
MIRT805599	hsa-miR-2467-3p	CLIP-seq
MIRT805600	hsa-miR-3122	CLIP-seq
MIRT805601	hsa-miR-3156-3p	CLIP-seq
MIRT805602	hsa-miR-3187-5p	CLIP-seq
MIRT805603	hsa-miR-3192	CLIP-seq
MIRT805604	hsa-miR-326	CLIP-seq
MIRT805605	hsa-miR-330-5p	CLIP-seq
MIRT805606	hsa-miR-3689a-3p	CLIP-seq
MIRT805607	hsa-miR-3689c	CLIP-seq
MIRT805608	hsa-miR-3691-3p	CLIP-seq
MIRT805609	hsa-miR-378g	CLIP-seq
MIRT805610	hsa-miR-3913-5p	CLIP-seq
MIRT805611	hsa-miR-4301	CLIP-seq
MIRT805612	hsa-miR-4314	CLIP-seq
MIRT805613	hsa-miR-4434	CLIP-seq
MIRT805614	hsa-miR-4467	CLIP-seq
MIRT805615	hsa-miR-4516	CLIP-seq
MIRT805616	hsa-miR-4646-5p	CLIP-seq
MIRT805617	hsa-miR-4701-5p	CLIP-seq
MIRT805618	hsa-miR-4726-3p	CLIP-seq
MIRT805619	hsa-miR-4728-5p	CLIP-seq
MIRT805620	hsa-miR-4746-3p	CLIP-seq
MIRT805621	hsa-miR-4751	CLIP-seq
MIRT805622	hsa-miR-4802-5p	CLIP-seq
MIRT805623	hsa-miR-483-3p	CLIP-seq
MIRT805624	hsa-miR-532-3p	CLIP-seq
MIRT805625	hsa-miR-579	CLIP-seq
MIRT805626	hsa-miR-588	CLIP-seq
MIRT805627	hsa-miR-612	CLIP-seq
MIRT805628	hsa-miR-625	CLIP-seq
MIRT805629	hsa-miR-765	CLIP-seq
MIRT805630	hsa-miR-922	CLIP-seq
MIRT1937892	hsa-miR-126	CLIP-seq
MIRT805593	hsa-miR-1285	CLIP-seq
MIRT805594	hsa-miR-1343	CLIP-seq
MIRT1937893	hsa-miR-141	CLIP-seq
MIRT1937894	hsa-miR-1912	CLIP-seq
MIRT805596	hsa-miR-193a-3p	CLIP-seq
MIRT805597	hsa-miR-193b	CLIP-seq
MIRT1937895	hsa-miR-200a	CLIP-seq
MIRT1937896	hsa-miR-204	CLIP-seq
MIRT1937897	hsa-miR-211	CLIP-seq
MIRT805599	hsa-miR-2467-3p	CLIP-seq
MIRT1937898	hsa-miR-3130-5p	CLIP-seq
MIRT805602	hsa-miR-3187-5p	CLIP-seq
MIRT1937899	hsa-miR-4267	CLIP-seq
MIRT1937900	hsa-miR-4279	CLIP-seq
MIRT1937901	hsa-miR-4482	CLIP-seq
MIRT1937902	hsa-miR-4638-5p	CLIP-seq
MIRT805617	hsa-miR-4701-5p	CLIP-seq
MIRT805623	hsa-miR-483-3p	CLIP-seq
MIRT805626	hsa-miR-588	CLIP-seq
MIRT805627	hsa-miR-612	CLIP-seq
MIRT805628	hsa-miR-625	CLIP-seq
MIRT805630	hsa-miR-922	CLIP-seq
MIRT2177416	hsa-miR-1208	CLIP-seq
MIRT2177417	hsa-miR-3714	CLIP-seq
MIRT1937899	hsa-miR-4267	CLIP-seq
MIRT2177418	hsa-miR-4505	CLIP-seq
MIRT1937902	hsa-miR-4638-5p	CLIP-seq
MIRT2177419	hsa-miR-4704-3p	CLIP-seq
MIRT2177420	hsa-miR-4731-5p	CLIP-seq
MIRT805628	hsa-miR-625	CLIP-seq
MIRT2177421	hsa-miR-892b	CLIP-seq
MIRT2444173	hsa-miR-10a	CLIP-seq
MIRT2444174	hsa-miR-10b	CLIP-seq
MIRT2444175	hsa-miR-1205	CLIP-seq
MIRT2444176	hsa-miR-1207-3p	CLIP-seq
MIRT2444177	hsa-miR-1207-5p	CLIP-seq
MIRT2444178	hsa-miR-1224-3p	CLIP-seq
MIRT2444179	hsa-miR-1236	CLIP-seq
MIRT2444180	hsa-miR-1238	CLIP-seq
MIRT2444181	hsa-miR-1245b-5p	CLIP-seq
MIRT805592	hsa-miR-1250	CLIP-seq
MIRT2444182	hsa-miR-1256	CLIP-seq
MIRT2444183	hsa-miR-1260	CLIP-seq
MIRT2444184	hsa-miR-1260b	CLIP-seq
MIRT2444185	hsa-miR-1262	CLIP-seq
MIRT2444186	hsa-miR-1267	CLIP-seq
MIRT2444187	hsa-miR-1271	CLIP-seq
MIRT2444188	hsa-miR-1280	CLIP-seq
MIRT2444189	hsa-miR-129-3p	CLIP-seq
MIRT2444190	hsa-miR-133a	CLIP-seq
MIRT2444191	hsa-miR-133b	CLIP-seq
MIRT2444192	hsa-miR-146a	CLIP-seq
MIRT2444193	hsa-miR-146b-5p	CLIP-seq
MIRT2444194	hsa-miR-181a	CLIP-seq
MIRT2444195	hsa-miR-181b	CLIP-seq
MIRT2444196	hsa-miR-181c	CLIP-seq
MIRT2444197	hsa-miR-181d	CLIP-seq
MIRT2444198	hsa-miR-182	CLIP-seq
MIRT2444199	hsa-miR-1827	CLIP-seq
MIRT2444200	hsa-miR-186	CLIP-seq
MIRT2444201	hsa-miR-190	CLIP-seq
MIRT2444202	hsa-miR-190b	CLIP-seq
MIRT805595	hsa-miR-1915	CLIP-seq
MIRT2444203	hsa-miR-192	CLIP-seq
MIRT2444204	hsa-miR-1972	CLIP-seq
MIRT1937896	hsa-miR-204	CLIP-seq
MIRT2444205	hsa-miR-2053	CLIP-seq
MIRT2444206	hsa-miR-210	CLIP-seq
MIRT1937897	hsa-miR-211	CLIP-seq
MIRT2444207	hsa-miR-2115	CLIP-seq
MIRT2444208	hsa-miR-215	CLIP-seq
MIRT2444209	hsa-miR-217	CLIP-seq
MIRT805599	hsa-miR-2467-3p	CLIP-seq
MIRT2444210	hsa-miR-2467-5p	CLIP-seq
MIRT2444211	hsa-miR-2682	CLIP-seq
MIRT2444212	hsa-miR-2861	CLIP-seq
MIRT2444213	hsa-miR-298	CLIP-seq
MIRT2444214	hsa-miR-3120-5p	CLIP-seq
MIRT2444215	hsa-miR-3126-3p	CLIP-seq
MIRT2444216	hsa-miR-3133	CLIP-seq
MIRT2444217	hsa-miR-3136-3p	CLIP-seq
MIRT2444218	hsa-miR-3137	CLIP-seq
MIRT2444219	hsa-miR-3142	CLIP-seq
MIRT2444220	hsa-miR-3148	CLIP-seq
MIRT2444221	hsa-miR-3154	CLIP-seq
MIRT805601	hsa-miR-3156-3p	CLIP-seq
MIRT2444222	hsa-miR-3162-3p	CLIP-seq
MIRT2444223	hsa-miR-3169	CLIP-seq
MIRT2444224	hsa-miR-3170	CLIP-seq
MIRT2444225	hsa-miR-3179	CLIP-seq
MIRT2444226	hsa-miR-3185	CLIP-seq
MIRT805603	hsa-miR-3192	CLIP-seq
MIRT2444227	hsa-miR-324-5p	CLIP-seq
MIRT2444228	hsa-miR-331-3p	CLIP-seq
MIRT2444229	hsa-miR-331-5p	CLIP-seq
MIRT2444230	hsa-miR-339-5p	CLIP-seq
MIRT2444231	hsa-miR-342-5p	CLIP-seq
MIRT2444232	hsa-miR-345	CLIP-seq
MIRT2444233	hsa-miR-346	CLIP-seq
MIRT2444234	hsa-miR-3605-3p	CLIP-seq
MIRT2444235	hsa-miR-3607-5p	CLIP-seq
MIRT2444236	hsa-miR-3612	CLIP-seq
MIRT2444237	hsa-miR-3653	CLIP-seq
MIRT2444238	hsa-miR-3657	CLIP-seq
MIRT2444239	hsa-miR-3668	CLIP-seq
MIRT2444240	hsa-miR-3674	CLIP-seq
MIRT2444241	hsa-miR-3686	CLIP-seq
MIRT2444242	hsa-miR-3689a-5p	CLIP-seq
MIRT2444243	hsa-miR-3689b	CLIP-seq
MIRT2444244	hsa-miR-3689d	CLIP-seq
MIRT2444245	hsa-miR-3689e	CLIP-seq
MIRT2444246	hsa-miR-3689f	CLIP-seq
MIRT2177417	hsa-miR-3714	CLIP-seq
MIRT805609	hsa-miR-378g	CLIP-seq
MIRT2444247	hsa-miR-3913-3p	CLIP-seq
MIRT2444248	hsa-miR-3919	CLIP-seq
MIRT2444249	hsa-miR-3943	CLIP-seq
MIRT2444250	hsa-miR-3978	CLIP-seq
MIRT2444251	hsa-miR-4254	CLIP-seq
MIRT2444252	hsa-miR-4256	CLIP-seq
MIRT2444253	hsa-miR-4262	CLIP-seq
MIRT1937899	hsa-miR-4267	CLIP-seq
MIRT2444254	hsa-miR-4268	CLIP-seq
MIRT1937900	hsa-miR-4279	CLIP-seq
MIRT2444255	hsa-miR-4283	CLIP-seq
MIRT2444256	hsa-miR-4284	CLIP-seq
MIRT2444257	hsa-miR-4287	CLIP-seq
MIRT2444258	hsa-miR-4288	CLIP-seq
MIRT2444259	hsa-miR-4292	CLIP-seq
MIRT805611	hsa-miR-4301	CLIP-seq
MIRT2444260	hsa-miR-4308	CLIP-seq
MIRT2444261	hsa-miR-4313	CLIP-seq
MIRT805612	hsa-miR-4314	CLIP-seq
MIRT2444262	hsa-miR-4328	CLIP-seq
MIRT2444263	hsa-miR-4418	CLIP-seq
MIRT2444264	hsa-miR-4421	CLIP-seq
MIRT2444265	hsa-miR-4448	CLIP-seq
MIRT2444266	hsa-miR-4452	CLIP-seq
MIRT2444267	hsa-miR-4455	CLIP-seq
MIRT2444268	hsa-miR-4457	CLIP-seq
MIRT805614	hsa-miR-4467	CLIP-seq
MIRT2444269	hsa-miR-4468	CLIP-seq
MIRT2444270	hsa-miR-4496	CLIP-seq
MIRT2444271	hsa-miR-449c	CLIP-seq
MIRT2444272	hsa-miR-450b-5p	CLIP-seq
MIRT2444273	hsa-miR-4515	CLIP-seq
MIRT2444274	hsa-miR-4519	CLIP-seq
MIRT2444275	hsa-miR-452	CLIP-seq
MIRT2444276	hsa-miR-4642	CLIP-seq
MIRT805616	hsa-miR-4646-5p	CLIP-seq
MIRT2444277	hsa-miR-4648	CLIP-seq
MIRT2444278	hsa-miR-4650-5p	CLIP-seq
MIRT2444279	hsa-miR-4651	CLIP-seq
MIRT2444280	hsa-miR-4652-3p	CLIP-seq
MIRT2444281	hsa-miR-4654	CLIP-seq
MIRT2444282	hsa-miR-4664-5p	CLIP-seq
MIRT2444283	hsa-miR-4669	CLIP-seq
MIRT2444284	hsa-miR-4670-3p	CLIP-seq
MIRT2444285	hsa-miR-4676-3p	CLIP-seq
MIRT2444286	hsa-miR-4677-3p	CLIP-seq
MIRT2444287	hsa-miR-4678	CLIP-seq
MIRT2444288	hsa-miR-4679	CLIP-seq
MIRT2444289	hsa-miR-4685-3p	CLIP-seq
MIRT2444290	hsa-miR-4694-5p	CLIP-seq
MIRT2444291	hsa-miR-4695-5p	CLIP-seq
MIRT2444292	hsa-miR-4701-3p	CLIP-seq
MIRT2444293	hsa-miR-4709-3p	CLIP-seq
MIRT2444294	hsa-miR-4711-3p	CLIP-seq
MIRT805618	hsa-miR-4726-3p	CLIP-seq
MIRT2444295	hsa-miR-4729	CLIP-seq
MIRT2177420	hsa-miR-4731-5p	CLIP-seq
MIRT2444296	hsa-miR-4736	CLIP-seq
MIRT2444297	hsa-miR-4738-3p	CLIP-seq
MIRT805620	hsa-miR-4746-3p	CLIP-seq
MIRT2444298	hsa-miR-4753-3p	CLIP-seq
MIRT2444299	hsa-miR-4763-3p	CLIP-seq
MIRT2444300	hsa-miR-4763-5p	CLIP-seq
MIRT2444301	hsa-miR-4769-5p	CLIP-seq
MIRT2444302	hsa-miR-4775	CLIP-seq
MIRT2444303	hsa-miR-4786-5p	CLIP-seq
MIRT2444304	hsa-miR-4796-3p	CLIP-seq
MIRT2444305	hsa-miR-4797-5p	CLIP-seq
MIRT805623	hsa-miR-483-3p	CLIP-seq
MIRT2444306	hsa-miR-486-3p	CLIP-seq
MIRT2444307	hsa-miR-489	CLIP-seq
MIRT2444308	hsa-miR-502-5p	CLIP-seq
MIRT2444309	hsa-miR-507	CLIP-seq
MIRT2444310	hsa-miR-509-3-5p	CLIP-seq
MIRT2444311	hsa-miR-509-5p	CLIP-seq
MIRT2444312	hsa-miR-513b	CLIP-seq
MIRT2444313	hsa-miR-516a-3p	CLIP-seq
MIRT805624	hsa-miR-532-3p	CLIP-seq
MIRT2444314	hsa-miR-539	CLIP-seq
MIRT2444315	hsa-miR-548c-3p	CLIP-seq
MIRT2444316	hsa-miR-548q	CLIP-seq
MIRT2444317	hsa-miR-548t	CLIP-seq
MIRT2444318	hsa-miR-556-3p	CLIP-seq
MIRT2444319	hsa-miR-557	CLIP-seq
MIRT2444320	hsa-miR-569	CLIP-seq
MIRT2444321	hsa-miR-580	CLIP-seq
MIRT2444322	hsa-miR-582-5p	CLIP-seq
MIRT2444323	hsa-miR-589	CLIP-seq
MIRT2444324	hsa-miR-592	CLIP-seq
MIRT2444325	hsa-miR-599	CLIP-seq
MIRT2444326	hsa-miR-604	CLIP-seq
MIRT2444327	hsa-miR-608	CLIP-seq
MIRT2444328	hsa-miR-632	CLIP-seq
MIRT2444329	hsa-miR-643	CLIP-seq
MIRT2444330	hsa-miR-647	CLIP-seq
MIRT2444331	hsa-miR-650	CLIP-seq
MIRT2444332	hsa-miR-653	CLIP-seq
MIRT2444333	hsa-miR-661	CLIP-seq
MIRT2444334	hsa-miR-759	CLIP-seq
MIRT2444335	hsa-miR-760	CLIP-seq
MIRT805629	hsa-miR-765	CLIP-seq
MIRT2444336	hsa-miR-769-5p	CLIP-seq
MIRT805630	hsa-miR-922	CLIP-seq
MIRT2444337	hsa-miR-940	CLIP-seq
MIRT2444338	hsa-miR-942	CLIP-seq
MIRT2444339	hsa-miR-96	CLIP-seq
MIRT2444175	hsa-miR-1205	CLIP-seq
MIRT2444178	hsa-miR-1224-3p	CLIP-seq
MIRT2444180	hsa-miR-1238	CLIP-seq
MIRT2444181	hsa-miR-1245b-5p	CLIP-seq
MIRT2444182	hsa-miR-1256	CLIP-seq
MIRT2444183	hsa-miR-1260	CLIP-seq
MIRT2444184	hsa-miR-1260b	CLIP-seq
MIRT2444185	hsa-miR-1262	CLIP-seq
MIRT2444187	hsa-miR-1271	CLIP-seq
MIRT2444188	hsa-miR-1280	CLIP-seq
MIRT2464888	hsa-miR-1291	CLIP-seq
MIRT2444189	hsa-miR-129-3p	CLIP-seq
MIRT2444190	hsa-miR-133a	CLIP-seq
MIRT2444191	hsa-miR-133b	CLIP-seq
MIRT2444192	hsa-miR-146a	CLIP-seq
MIRT2444193	hsa-miR-146b-5p	CLIP-seq
MIRT2444194	hsa-miR-181a	CLIP-seq
MIRT2444195	hsa-miR-181b	CLIP-seq
MIRT2444196	hsa-miR-181c	CLIP-seq
MIRT2444197	hsa-miR-181d	CLIP-seq
MIRT2444198	hsa-miR-182	CLIP-seq
MIRT2444201	hsa-miR-190	CLIP-seq
MIRT2444202	hsa-miR-190b	CLIP-seq
MIRT2464889	hsa-miR-1914	CLIP-seq
MIRT805595	hsa-miR-1915	CLIP-seq
MIRT2444204	hsa-miR-1972	CLIP-seq
MIRT2444207	hsa-miR-2115	CLIP-seq
MIRT2444211	hsa-miR-2682	CLIP-seq
MIRT2444214	hsa-miR-3120-5p	CLIP-seq
MIRT2464890	hsa-miR-3130-3p	CLIP-seq
MIRT2444218	hsa-miR-3137	CLIP-seq
MIRT2444219	hsa-miR-3142	CLIP-seq
MIRT2444220	hsa-miR-3148	CLIP-seq
MIRT805601	hsa-miR-3156-3p	CLIP-seq
MIRT2464891	hsa-miR-3173-5p	CLIP-seq
MIRT2444227	hsa-miR-324-5p	CLIP-seq
MIRT2444228	hsa-miR-331-3p	CLIP-seq
MIRT2444230	hsa-miR-339-5p	CLIP-seq
MIRT2444231	hsa-miR-342-5p	CLIP-seq
MIRT2444233	hsa-miR-346	CLIP-seq
MIRT2444238	hsa-miR-3657	CLIP-seq
MIRT2444241	hsa-miR-3686	CLIP-seq
MIRT2444242	hsa-miR-3689a-5p	CLIP-seq
MIRT2444243	hsa-miR-3689b	CLIP-seq
MIRT2444244	hsa-miR-3689d	CLIP-seq
MIRT2444245	hsa-miR-3689e	CLIP-seq
MIRT2444246	hsa-miR-3689f	CLIP-seq
MIRT2177417	hsa-miR-3714	CLIP-seq
MIRT805609	hsa-miR-378g	CLIP-seq
MIRT2444247	hsa-miR-3913-3p	CLIP-seq
MIRT2444253	hsa-miR-4262	CLIP-seq
MIRT2444254	hsa-miR-4268	CLIP-seq
MIRT1937900	hsa-miR-4279	CLIP-seq
MIRT2444258	hsa-miR-4288	CLIP-seq
MIRT2444259	hsa-miR-4292	CLIP-seq
MIRT805611	hsa-miR-4301	CLIP-seq
MIRT2444264	hsa-miR-4421	CLIP-seq
MIRT2444265	hsa-miR-4448	CLIP-seq
MIRT2444267	hsa-miR-4455	CLIP-seq
MIRT2444270	hsa-miR-4496	CLIP-seq
MIRT2444271	hsa-miR-449c	CLIP-seq
MIRT2444272	hsa-miR-450b-5p	CLIP-seq
MIRT2444276	hsa-miR-4642	CLIP-seq
MIRT2444278	hsa-miR-4650-5p	CLIP-seq
MIRT2444279	hsa-miR-4651	CLIP-seq
MIRT2444280	hsa-miR-4652-3p	CLIP-seq
MIRT2444282	hsa-miR-4664-5p	CLIP-seq
MIRT2444283	hsa-miR-4669	CLIP-seq
MIRT2444286	hsa-miR-4677-3p	CLIP-seq
MIRT2444288	hsa-miR-4679	CLIP-seq
MIRT2444290	hsa-miR-4694-5p	CLIP-seq
MIRT2444292	hsa-miR-4701-3p	CLIP-seq
MIRT805618	hsa-miR-4726-3p	CLIP-seq
MIRT2444295	hsa-miR-4729	CLIP-seq
MIRT2177420	hsa-miR-4731-5p	CLIP-seq
MIRT2444304	hsa-miR-4796-3p	CLIP-seq
MIRT2444305	hsa-miR-4797-5p	CLIP-seq
MIRT805623	hsa-miR-483-3p	CLIP-seq
MIRT2444307	hsa-miR-489	CLIP-seq
MIRT2444308	hsa-miR-502-5p	CLIP-seq
MIRT2444309	hsa-miR-507	CLIP-seq
MIRT2444313	hsa-miR-516a-3p	CLIP-seq
MIRT805624	hsa-miR-532-3p	CLIP-seq
MIRT2444314	hsa-miR-539	CLIP-seq
MIRT2444315	hsa-miR-548c-3p	CLIP-seq
MIRT2444317	hsa-miR-548t	CLIP-seq
MIRT2444319	hsa-miR-557	CLIP-seq
MIRT2444321	hsa-miR-580	CLIP-seq
MIRT2444323	hsa-miR-589	CLIP-seq
MIRT2444326	hsa-miR-604	CLIP-seq
MIRT2444327	hsa-miR-608	CLIP-seq
MIRT2444328	hsa-miR-632	CLIP-seq
MIRT2444329	hsa-miR-643	CLIP-seq
MIRT2444330	hsa-miR-647	CLIP-seq
MIRT2444334	hsa-miR-759	CLIP-seq
MIRT2444335	hsa-miR-760	CLIP-seq
MIRT805629	hsa-miR-765	CLIP-seq
MIRT2444339	hsa-miR-96	CLIP-seq
MIRT2444278	hsa-miR-4650-5p	CLIP-seq
MIRT2444305	hsa-miR-4797-5p	CLIP-seq
MIRT2444314	hsa-miR-539	CLIP-seq
MIRT2444175	hsa-miR-1205	CLIP-seq
MIRT2444180	hsa-miR-1238	CLIP-seq
MIRT2444181	hsa-miR-1245b-5p	CLIP-seq
MIRT2464888	hsa-miR-1291	CLIP-seq
MIRT2444200	hsa-miR-186	CLIP-seq
MIRT2444201	hsa-miR-190	CLIP-seq
MIRT2444202	hsa-miR-190b	CLIP-seq
MIRT2464889	hsa-miR-1914	CLIP-seq
MIRT2444206	hsa-miR-210	CLIP-seq
MIRT2444211	hsa-miR-2682	CLIP-seq
MIRT2464890	hsa-miR-3130-3p	CLIP-seq
MIRT2444216	hsa-miR-3133	CLIP-seq
MIRT2480879	hsa-miR-3138	CLIP-seq
MIRT2444219	hsa-miR-3142	CLIP-seq
MIRT2444221	hsa-miR-3154	CLIP-seq
MIRT2464891	hsa-miR-3173-5p	CLIP-seq
MIRT2444225	hsa-miR-3179	CLIP-seq
MIRT2444234	hsa-miR-3605-3p	CLIP-seq
MIRT2444237	hsa-miR-3653	CLIP-seq
MIRT2444238	hsa-miR-3657	CLIP-seq
MIRT2444242	hsa-miR-3689a-5p	CLIP-seq
MIRT2444243	hsa-miR-3689b	CLIP-seq
MIRT2444244	hsa-miR-3689d	CLIP-seq
MIRT2444245	hsa-miR-3689e	CLIP-seq
MIRT2444246	hsa-miR-3689f	CLIP-seq
MIRT2177417	hsa-miR-3714	CLIP-seq
MIRT2444248	hsa-miR-3919	CLIP-seq
MIRT2444249	hsa-miR-3943	CLIP-seq
MIRT2444252	hsa-miR-4256	CLIP-seq
MIRT2444254	hsa-miR-4268	CLIP-seq
MIRT2444255	hsa-miR-4283	CLIP-seq
MIRT2444261	hsa-miR-4313	CLIP-seq
MIRT2444265	hsa-miR-4448	CLIP-seq
MIRT2444271	hsa-miR-449c	CLIP-seq
MIRT2480880	hsa-miR-4522	CLIP-seq
MIRT2444278	hsa-miR-4650-5p	CLIP-seq
MIRT2444283	hsa-miR-4669	CLIP-seq
MIRT2444284	hsa-miR-4670-3p	CLIP-seq
MIRT2444286	hsa-miR-4677-3p	CLIP-seq
MIRT2444288	hsa-miR-4679	CLIP-seq
MIRT2444290	hsa-miR-4694-5p	CLIP-seq
MIRT2444295	hsa-miR-4729	CLIP-seq
MIRT2177420	hsa-miR-4731-5p	CLIP-seq
MIRT2480881	hsa-miR-4752	CLIP-seq
MIRT2444300	hsa-miR-4763-5p	CLIP-seq
MIRT2444303	hsa-miR-4786-5p	CLIP-seq
MIRT2480882	hsa-miR-4793-3p	CLIP-seq
MIRT2444305	hsa-miR-4797-5p	CLIP-seq
MIRT2480883	hsa-miR-4800-5p	CLIP-seq
MIRT2444313	hsa-miR-516a-3p	CLIP-seq
MIRT2444314	hsa-miR-539	CLIP-seq
MIRT2444326	hsa-miR-604	CLIP-seq
MIRT2444329	hsa-miR-643	CLIP-seq
MIRT2444330	hsa-miR-647	CLIP-seq
MIRT2444334	hsa-miR-759	CLIP-seq
MIRT2444335	hsa-miR-760	CLIP-seq
MIRT2444336	hsa-miR-769-5p	CLIP-seq
MIRT2444175	hsa-miR-1205	CLIP-seq
MIRT2444181	hsa-miR-1245b-5p	CLIP-seq
MIRT2464888	hsa-miR-1291	CLIP-seq
MIRT2444190	hsa-miR-133a	CLIP-seq
MIRT2444191	hsa-miR-133b	CLIP-seq
MIRT2464889	hsa-miR-1914	CLIP-seq
MIRT2464890	hsa-miR-3130-3p	CLIP-seq
MIRT2480879	hsa-miR-3138	CLIP-seq
MIRT2444219	hsa-miR-3142	CLIP-seq
MIRT2444221	hsa-miR-3154	CLIP-seq
MIRT2464891	hsa-miR-3173-5p	CLIP-seq
MIRT2444225	hsa-miR-3179	CLIP-seq
MIRT2444228	hsa-miR-331-3p	CLIP-seq
MIRT2444231	hsa-miR-342-5p	CLIP-seq
MIRT2444234	hsa-miR-3605-3p	CLIP-seq
MIRT2444237	hsa-miR-3653	CLIP-seq
MIRT2444244	hsa-miR-3689d	CLIP-seq
MIRT2444249	hsa-miR-3943	CLIP-seq
MIRT2444254	hsa-miR-4268	CLIP-seq
MIRT2444255	hsa-miR-4283	CLIP-seq
MIRT2444259	hsa-miR-4292	CLIP-seq
MIRT2444261	hsa-miR-4313	CLIP-seq
MIRT2444265	hsa-miR-4448	CLIP-seq
MIRT2444267	hsa-miR-4455	CLIP-seq
MIRT2480880	hsa-miR-4522	CLIP-seq
MIRT2444278	hsa-miR-4650-5p	CLIP-seq
MIRT2444279	hsa-miR-4651	CLIP-seq
MIRT2444282	hsa-miR-4664-5p	CLIP-seq
MIRT2444284	hsa-miR-4670-3p	CLIP-seq
MIRT2444295	hsa-miR-4729	CLIP-seq
MIRT2480881	hsa-miR-4752	CLIP-seq
MIRT2444300	hsa-miR-4763-5p	CLIP-seq
MIRT2480882	hsa-miR-4793-3p	CLIP-seq
MIRT2444304	hsa-miR-4796-3p	CLIP-seq
MIRT2444305	hsa-miR-4797-5p	CLIP-seq
MIRT2480883	hsa-miR-4800-5p	CLIP-seq
MIRT2444314	hsa-miR-539	CLIP-seq
MIRT2444317	hsa-miR-548t	CLIP-seq
MIRT2444326	hsa-miR-604	CLIP-seq
MIRT2444327	hsa-miR-608	CLIP-seq
MIRT2444329	hsa-miR-643	CLIP-seq
MIRT2444330	hsa-miR-647	CLIP-seq
MIRT2444334	hsa-miR-759	CLIP-seq
MIRT2444335	hsa-miR-760	CLIP-seq
MIRT805629	hsa-miR-765	CLIP-seq
MIRT2444295	hsa-miR-4729	CLIP-seq
MIRT2444305	hsa-miR-4797-5p	CLIP-seq
MIRT2444314	hsa-miR-539	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HSF1	Activation	23386620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IDA	37943659
GO:0000045	Process	Autophagosome assembly	IMP	33446636
GO:0000045	Process	Autophagosome assembly	IMP	22170151
GO:0000407	Component	Phagophore assembly site	IBA
GO:0000407	Component	Phagophore assembly site	IDA	37943659
GO:0000407	Component	Phagophore assembly site	IEA
GO:0000423	Process	Mitophagy	IBA
GO:0000423	Process	Mitophagy	IGI	19279012
GO:0005515	Function	Protein binding	IPI	11096062, 11825910, 16303767, 18083104, 18296641, 20195357, 20543840, 20562859, 21903422, 22499945, 24186333, 26043688, 28514442, 32814053, 33961781, 34524948, 37252361
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	20543840
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005930	Component	Axoneme	ISS
GO:0006497	Process	Protein lipidation	IDA	12890687
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IGI	28389568
GO:0006914	Process	Autophagy	IMP	25327288
GO:0006914	Process	Autophagy	IMP	20543840, 24681637
GO:0006914	Process	Autophagy	ISS
GO:0006995	Process	Cellular response to nitrogen starvation	IBA
GO:0008641	Function	Ubiquitin-like modifier activating enzyme activity	IEA
GO:0009267	Process	Cellular response to starvation	IDA	20543840
GO:0009896	Process	Positive regulation of catabolic process	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016236	Process	Macroautophagy	IMP	22354037
GO:0019778	Function	Atg12 activating enzyme activity	IBA
GO:0019778	Function	Atg12 activating enzyme activity	IDA	37943659
GO:0019778	Function	Atg12 activating enzyme activity	IMP	22170151
GO:0019778	Function	Atg12 activating enzyme activity	ISS	20723759
GO:0019779	Function	Atg8 activating enzyme activity	IBA
GO:0031401	Process	Positive regulation of protein modification process	IDA	12890687
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032446	Process	Protein modification by small protein conjugation	IBA
GO:0033554	Process	Cellular response to stress	IDA	37943659
GO:0034727	Process	Piecemeal microautophagy of the nucleus	IBA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042803	Function	Protein homodimerization activity	IDA	11096062
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	20543840
GO:0045732	Process	Positive regulation of protein catabolic process	IMP	20543840
GO:0048511	Process	Rhythmic process	IEA
GO:0051607	Process	Defense response to virus	IMP	23290079
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0071455	Process	Cellular response to hyperoxia	IDA	20543840
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

Other IDs

• MIM: 608760
• HGNC: 16935
• e!Ensembl: ENSG00000197548

Protein

• UniProt ID: O95352
• Protein name: Ubiquitin-like modifier-activating enzyme ATG7 (ATG12-activating enzyme E1 ATG7) (Autophagy-related protein 7) (APG7-like) (hAGP7) (Ubiquitin-activating enzyme E1-like protein)
• Protein function: E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 as well as the ATG8 family proteins for their conjugation with phos
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16420	ATG7_N	13 → 323	Ubiquitin-like modifier-activating enzyme ATG7 N-terminus	Domain
  PF00899	ThiF	333 → 648	ThiF family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, especially in kidney, liver, lymph nodes and bone marrow. {ECO:0000269|PubMed:11890701}.
• Sequence:

  MAAATGDPGLSKLQFAPFSSALDVGFWHELTQKKLNEYRLDEAPKDIKGYYYNGDSAGLP
  ARLTLEFSAFDMSAPTPARCCPAIGTLYNTNTLESFKTADKKLLLEQAANEIWESIKSGT
  ALENPVLLNKFLLLTFADLKKYHFYYWFCYPALCLPESLPLIQGPVGLDQRFSLKQIEAL
  ECAYDNLCQTEGVTALPYFLIKYDENMVLVSLLKHYSDFFQGQRTKITIGVYDPCNLAQY
  PGWPLRNFLVLAAHRWSSSFQSVEVVCFRDRTMQGARDVAHSIIFEVKLPEMAFSPDCPK
  AVGWEKNQKGGMGPRMVNLSECMDPKRLAESSVDLNLKLMCWRLVPTLDLDKVVSVKCLL
  LGAGTLGCNVARTLMGWGVRHITFVDNAKISYSNPVRQPLYEFEDCLGGGKPKALAAADR
  LQKIFPGVNARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRES
  RWLPAVIAASKRKLVINAALGFDTFVVMRHGLKKPKQQGAGDLCPNHPVASADLLGSSLF
  ANIPGYKLGCYFCNDVVAPGDSTRDRTLDQQCTVSRPGLAVIAGALAVELMVSVLQHPEG
  GYAIASSSDDRMNEPPTSLGLVPHQIRGFLSRFDNVLPVSLAFDKCTACSSKVLDQYERE
  GFNFLAKVFNSSHSFLEDLTGLTLLHQETQAAEIWDMSDDETI

• Sequence length: 703

Pathways

KEGG:

Autophagy - other
Autophagy - animal
Ferroptosis
Neutrophil extracellular trap formation

Reactome:

Macroautophagy
Neutrophil degranulation
Signaling by BRAF and RAF fusions
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Nonpapillary renal cell carcinoma	Pathogenic	rs200074530	RCV005911445	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spinocerebellar ataxia, autosomal recessive 31	Pathogenic	rs142493104, rs777067201, rs2152756968, rs2152811529, rs201706487, rs200074530	RCV001533545 RCV001533546 RCV001533547 RCV001533548 RCV001533550 RCV001533551	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATG7-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAFLD1	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian failure	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL VESSEL STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	27091640		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	31531087		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28703808		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	14976209		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24362353		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35500219	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	31090940		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	29089548		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	26468292		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29039784	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31332160		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30654731, 31242080		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29291982		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	23821365		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	26568842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24305049		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29273297		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30619297		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26701229		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26701229	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30619297		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	35777002, 39741278, 40527779	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30158642		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33706714	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	27400854		★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	35710416	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28624205, 30483807, 30635654, 30666128, 30871066, 31016112		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23637631, 24681637, 28669927, 28981380, 28987884, 29545903, 30988371		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19944062, 20083906, 23386620, 25573951	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25342595, 29676845, 32964966, 33495541, 34691238, 35405176, 38554427	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	31180579	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28624205, 30483807, 30635654, 30666128, 30871066, 31016112		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10709110, 23965987, 24203955, 29207165, 30573163		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24998849	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26208877, 35812454	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29022892, 29794480, 30570864		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28208686	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Diseases	Cerebellar diseases	Pubtator	34161705	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29123153	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	29125039		★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	31749688		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29123153, 30555402		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26681037		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26681037		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	22536318		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35725745, 40696630	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29078374		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26214133, 27981410		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26163626, 32046105	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29273297, 29438013		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24998849, 26208877, 30827239		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35777002	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	36180886	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	34161705	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33019392, 33085184, 37311265	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28573460, 31160616		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	37522124	Inhibit	★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	29273297, 29416002		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	30081710		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	34161705	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26208877		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26208877, 40138919	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34809787	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34809787	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis Bullosa Simplex Superficialis	Epidermolysis Bullosa	BEFREE	28450279		★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	34161705	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27077802		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35405176	Associate	★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	31843092		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	31242080		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23792642, 28716053		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23792642	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23792642, 28716053		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28912153	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29273297, 29438013		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	27534900		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	20697744, 23894380		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	23894380	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	23959381, 24362353		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30026731		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	22257883		★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	BEFREE	22257883		★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	18320203		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31336911		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	30923461		★☆☆☆☆ Found in Text Mining only
INCLUSION BODY MYOPATHY WITH EARLY-ONSET PAGET DISEASE AND FRONTOTEMPORAL DEMENTIA	Inclusion Body Myopathy With Paget Disease And Frontotemporal Dementia	BEFREE	30654731		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33846806	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29123153		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30589566		★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	31843092	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22898604	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33077697	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	14976209	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27268264, 27797294, 31531087, 31593983		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	20174468		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21858812, 22927446, 25617127, 27301338, 27653365, 29191453, 29676845, 31218739, 31662980		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	29191453		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	35405176	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	35405176	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	BEFREE	28689811		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21858812		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26420661		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	CTD_human_DG	26568842		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	23637631, 24681637, 28669927, 28981380, 28987884, 29545903, 30988371		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10709110, 23965987, 24203955, 30573163		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	28408137		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29794480, 30570864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23637631, 28196025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29691294, 29995557		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28624205, 30483807, 30635654, 30666128, 30871066, 31016112		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22504094, 23792642, 25132405, 26208877, 27981410, 29960159, 30238850, 30341282, 30573163, 30635654, 31016112, 31612776		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	26681037		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25484078	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31645130		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35405176	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24971611		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	27184077		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	27184077, 27534900		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	30407747	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	23455503		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21300795, 21842312, 23258740, 23965987, 24875857, 24998849, 26214133, 26677873, 29424891, 30429607, 30536473, 31448672		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29311760		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	31749688		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26076903		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23959381, 29481833, 29593330, 30323972, 31232177		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29400609, 35405176, 37311265	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36674839	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	30654731		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30216504		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23527187, 31545241		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23527187, 36254233	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Dysgenesis 2	Ovarian dysgenesis	Pubtator	30224786	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	30224786		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	28408137		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29794480, 30570864		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20508647, 30570864, 39513923	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23637631, 28196025		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35288538, 35582016	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23821365		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23295909, 29804260, 31641108		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	35802825, 36593912	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31056990	Stimulate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	30389900		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29691294, 29995557		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23670050, 37929350	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25527499		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29424891		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	40628996	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28258192		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28131903		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24599075	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24599075		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28860495		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32139670, 33649532	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	29123153	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30005868	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28624205		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30773992, 30988371		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30988371	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28553083, 30635654	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30666128		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25803820, 26681037	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	24002033, 31843092		★☆☆☆☆ Found in Text Mining only
Vacuolar myopathy	Vacuolar Myopathy	BEFREE	23630012		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	30353556		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34961976	Associate	★☆☆☆☆ Found in Text Mining only