Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1052
Gene name	CCAAT enhancer binding protein delta
Gene symbol	CEBPD
Synonyms (NCBI Gene)	C/EBP-deltaCELFCRP3NF-IL6-beta
Chromosome	8
Chromosome location	8q11.21
Summary	The protein encoded by this intronless gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-alpha. The encoded protein is important in the regulati

215

Show/Hide all (215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027592	hsa-miR-98-5p	Microarray	19088304
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT643978	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT453703	hsa-miR-203b-5p	PAR-CLIP	23592263
MIRT453702	hsa-miR-6718-5p	PAR-CLIP	23592263
MIRT453701	hsa-miR-140-5p	PAR-CLIP	23592263
MIRT453700	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT453699	hsa-miR-4673	PAR-CLIP	23592263
MIRT453698	hsa-miR-6814-3p	PAR-CLIP	23592263
MIRT453697	hsa-miR-6872-5p	PAR-CLIP	23592263
MIRT453696	hsa-miR-3137	PAR-CLIP	23592263
MIRT453695	hsa-miR-103a-2-5p	PAR-CLIP	23592263
MIRT453694	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT453693	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT453692	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT453691	hsa-miR-4460	PAR-CLIP	23592263
MIRT453690	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT453689	hsa-miR-4426	PAR-CLIP	23592263
MIRT453688	hsa-miR-4647	PAR-CLIP	23592263
MIRT453687	hsa-miR-4662b	PAR-CLIP	23592263
MIRT453686	hsa-miR-3668	PAR-CLIP	23592263
MIRT453684	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT453685	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT453683	hsa-miR-421	PAR-CLIP	23592263
MIRT054423	hsa-miR-95-3p	qRT-PCRWestern blotLuciferase reporter assay	26165303
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT713044	hsa-miR-4999-3p	HITS-CLIP	19536157
MIRT713043	hsa-miR-455-3p	HITS-CLIP	19536157
MIRT713042	hsa-miR-6516-5p	HITS-CLIP	19536157
MIRT643978	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT453703	hsa-miR-203b-5p	PAR-CLIP	23592263
MIRT453702	hsa-miR-6718-5p	PAR-CLIP	23592263
MIRT453701	hsa-miR-140-5p	PAR-CLIP	23592263
MIRT453700	hsa-miR-4645-5p	PAR-CLIP	23592263
MIRT453699	hsa-miR-4673	PAR-CLIP	23592263
MIRT453698	hsa-miR-6814-3p	PAR-CLIP	23592263
MIRT453697	hsa-miR-6872-5p	PAR-CLIP	23592263
MIRT453696	hsa-miR-3137	PAR-CLIP	23592263
MIRT453695	hsa-miR-103a-2-5p	PAR-CLIP	23592263
MIRT453694	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT453693	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT453692	hsa-miR-4727-3p	PAR-CLIP	23592263
MIRT453691	hsa-miR-4460	PAR-CLIP	23592263
MIRT453690	hsa-miR-3591-5p	PAR-CLIP	23592263
MIRT453689	hsa-miR-4426	PAR-CLIP	23592263
MIRT453688	hsa-miR-4647	PAR-CLIP	23592263
MIRT453687	hsa-miR-4662b	PAR-CLIP	23592263
MIRT453686	hsa-miR-3668	PAR-CLIP	23592263
MIRT453684	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT453685	hsa-miR-4433a-3p	PAR-CLIP	23592263
MIRT453683	hsa-miR-421	PAR-CLIP	23592263
MIRT883307	hsa-let-7a	CLIP-seq
MIRT883308	hsa-let-7b	CLIP-seq
MIRT883309	hsa-let-7c	CLIP-seq
MIRT883310	hsa-let-7d	CLIP-seq
MIRT883311	hsa-let-7e	CLIP-seq
MIRT883312	hsa-let-7f	CLIP-seq
MIRT883313	hsa-let-7g	CLIP-seq
MIRT883314	hsa-let-7i	CLIP-seq
MIRT883315	hsa-miR-1184	CLIP-seq
MIRT883316	hsa-miR-1207-5p	CLIP-seq
MIRT883317	hsa-miR-1231	CLIP-seq
MIRT883318	hsa-miR-1238	CLIP-seq
MIRT883319	hsa-miR-1283	CLIP-seq
MIRT883320	hsa-miR-149	CLIP-seq
MIRT883321	hsa-miR-202	CLIP-seq
MIRT883322	hsa-miR-22	CLIP-seq
MIRT883323	hsa-miR-3064-5p	CLIP-seq
MIRT883324	hsa-miR-3115	CLIP-seq
MIRT883325	hsa-miR-3178	CLIP-seq
MIRT883326	hsa-miR-323-5p	CLIP-seq
MIRT883327	hsa-miR-338-5p	CLIP-seq
MIRT883328	hsa-miR-3545-5p	CLIP-seq
MIRT883329	hsa-miR-3615	CLIP-seq
MIRT883330	hsa-miR-4264	CLIP-seq
MIRT883331	hsa-miR-4288	CLIP-seq
MIRT883332	hsa-miR-4418	CLIP-seq
MIRT883333	hsa-miR-4436b-3p	CLIP-seq
MIRT883334	hsa-miR-4458	CLIP-seq
MIRT883335	hsa-miR-4500	CLIP-seq
MIRT883336	hsa-miR-4649-3p	CLIP-seq
MIRT883337	hsa-miR-4663	CLIP-seq
MIRT883338	hsa-miR-4685-5p	CLIP-seq
MIRT883339	hsa-miR-4711-5p	CLIP-seq
MIRT883340	hsa-miR-4738-3p	CLIP-seq
MIRT883341	hsa-miR-4763-3p	CLIP-seq
MIRT883342	hsa-miR-4766-5p	CLIP-seq
MIRT883343	hsa-miR-4768-5p	CLIP-seq
MIRT883344	hsa-miR-4794	CLIP-seq
MIRT883345	hsa-miR-509-3-5p	CLIP-seq
MIRT883346	hsa-miR-509-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT883349	hsa-miR-572	CLIP-seq
MIRT883350	hsa-miR-604	CLIP-seq
MIRT883351	hsa-miR-622	CLIP-seq
MIRT883352	hsa-miR-627	CLIP-seq
MIRT883353	hsa-miR-628-5p	CLIP-seq
MIRT883354	hsa-miR-632	CLIP-seq
MIRT883355	hsa-miR-647	CLIP-seq
MIRT883356	hsa-miR-760	CLIP-seq
MIRT883357	hsa-miR-924	CLIP-seq
MIRT883358	hsa-miR-941	CLIP-seq
MIRT883359	hsa-miR-942	CLIP-seq
MIRT883360	hsa-miR-98	CLIP-seq
MIRT883326	hsa-miR-323-5p	CLIP-seq
MIRT883328	hsa-miR-3545-5p	CLIP-seq
MIRT883329	hsa-miR-3615	CLIP-seq
MIRT883343	hsa-miR-4768-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT883359	hsa-miR-942	CLIP-seq
MIRT1961896	hsa-miR-105	CLIP-seq
MIRT883315	hsa-miR-1184	CLIP-seq
MIRT883316	hsa-miR-1207-5p	CLIP-seq
MIRT883317	hsa-miR-1231	CLIP-seq
MIRT883318	hsa-miR-1238	CLIP-seq
MIRT883319	hsa-miR-1283	CLIP-seq
MIRT883320	hsa-miR-149	CLIP-seq
MIRT883323	hsa-miR-3064-5p	CLIP-seq
MIRT883325	hsa-miR-3178	CLIP-seq
MIRT883327	hsa-miR-338-5p	CLIP-seq
MIRT1961897	hsa-miR-3671	CLIP-seq
MIRT883330	hsa-miR-4264	CLIP-seq
MIRT883331	hsa-miR-4288	CLIP-seq
MIRT883332	hsa-miR-4418	CLIP-seq
MIRT883333	hsa-miR-4436b-3p	CLIP-seq
MIRT883338	hsa-miR-4685-5p	CLIP-seq
MIRT883340	hsa-miR-4738-3p	CLIP-seq
MIRT883341	hsa-miR-4763-3p	CLIP-seq
MIRT883342	hsa-miR-4766-5p	CLIP-seq
MIRT883344	hsa-miR-4794	CLIP-seq
MIRT883345	hsa-miR-509-3-5p	CLIP-seq
MIRT883346	hsa-miR-509-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT883349	hsa-miR-572	CLIP-seq
MIRT1961898	hsa-miR-600	CLIP-seq
MIRT883350	hsa-miR-604	CLIP-seq
MIRT1961899	hsa-miR-607	CLIP-seq
MIRT883351	hsa-miR-622	CLIP-seq
MIRT883354	hsa-miR-632	CLIP-seq
MIRT883355	hsa-miR-647	CLIP-seq
MIRT883356	hsa-miR-760	CLIP-seq
MIRT883358	hsa-miR-941	CLIP-seq
MIRT883307	hsa-let-7a	CLIP-seq
MIRT883308	hsa-let-7b	CLIP-seq
MIRT883309	hsa-let-7c	CLIP-seq
MIRT883310	hsa-let-7d	CLIP-seq
MIRT883311	hsa-let-7e	CLIP-seq
MIRT883312	hsa-let-7f	CLIP-seq
MIRT883313	hsa-let-7g	CLIP-seq
MIRT883314	hsa-let-7i	CLIP-seq
MIRT883316	hsa-miR-1207-5p	CLIP-seq
MIRT883321	hsa-miR-202	CLIP-seq
MIRT883322	hsa-miR-22	CLIP-seq
MIRT883324	hsa-miR-3115	CLIP-seq
MIRT883325	hsa-miR-3178	CLIP-seq
MIRT883326	hsa-miR-323-5p	CLIP-seq
MIRT883328	hsa-miR-3545-5p	CLIP-seq
MIRT883329	hsa-miR-3615	CLIP-seq
MIRT883333	hsa-miR-4436b-3p	CLIP-seq
MIRT883334	hsa-miR-4458	CLIP-seq
MIRT883335	hsa-miR-4500	CLIP-seq
MIRT883336	hsa-miR-4649-3p	CLIP-seq
MIRT883338	hsa-miR-4685-5p	CLIP-seq
MIRT883339	hsa-miR-4711-5p	CLIP-seq
MIRT883341	hsa-miR-4763-3p	CLIP-seq
MIRT883343	hsa-miR-4768-5p	CLIP-seq
MIRT883359	hsa-miR-942	CLIP-seq
MIRT883360	hsa-miR-98	CLIP-seq
MIRT2427303	hsa-miR-1183	CLIP-seq
MIRT883317	hsa-miR-1231	CLIP-seq
MIRT883318	hsa-miR-1238	CLIP-seq
MIRT883319	hsa-miR-1283	CLIP-seq
MIRT2427304	hsa-miR-200b	CLIP-seq
MIRT2427305	hsa-miR-200c	CLIP-seq
MIRT883322	hsa-miR-22	CLIP-seq
MIRT2427306	hsa-miR-3163	CLIP-seq
MIRT883327	hsa-miR-338-5p	CLIP-seq
MIRT2427307	hsa-miR-3607-3p	CLIP-seq
MIRT2427308	hsa-miR-3609	CLIP-seq
MIRT883330	hsa-miR-4264	CLIP-seq
MIRT883331	hsa-miR-4288	CLIP-seq
MIRT2427309	hsa-miR-429	CLIP-seq
MIRT2427310	hsa-miR-4433	CLIP-seq
MIRT883339	hsa-miR-4711-5p	CLIP-seq
MIRT883342	hsa-miR-4766-5p	CLIP-seq
MIRT883347	hsa-miR-520d-5p	CLIP-seq
MIRT883348	hsa-miR-524-5p	CLIP-seq
MIRT2427311	hsa-miR-548ah	CLIP-seq
MIRT2427312	hsa-miR-548c-3p	CLIP-seq
MIRT2427313	hsa-miR-548t	CLIP-seq
MIRT883351	hsa-miR-622	CLIP-seq
MIRT883354	hsa-miR-632	CLIP-seq
MIRT2427314	hsa-miR-889	CLIP-seq
MIRT883315	hsa-miR-1184	CLIP-seq
MIRT883320	hsa-miR-149	CLIP-seq
MIRT883323	hsa-miR-3064-5p	CLIP-seq
MIRT883332	hsa-miR-4418	CLIP-seq
MIRT883340	hsa-miR-4738-3p	CLIP-seq
MIRT883344	hsa-miR-4794	CLIP-seq
MIRT883345	hsa-miR-509-3-5p	CLIP-seq
MIRT883346	hsa-miR-509-5p	CLIP-seq
MIRT883350	hsa-miR-604	CLIP-seq
MIRT883355	hsa-miR-647	CLIP-seq
MIRT883356	hsa-miR-760	CLIP-seq
MIRT883358	hsa-miR-941	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	20102225, 20805509
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225
GO:0005654	Component	Nucleoplasm	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225
GO:0006366	Process	Transcription by RNA polymerase II	TAS	8314590
GO:0042802	Function	Identical protein binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048839	Process	Inner ear development	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	20102225
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
116898	1835	ENSG00000221869

P49716

Protein name

CCAAT/enhancer-binding protein delta (C/EBP delta) (Nuclear factor NF-IL6-beta) (NF-IL6-beta)

Protein function

Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers (PubMed:16397300). Important transcription factor regulating the expression of

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07716	bZIP_2	190 → 243	Basic region leucine zipper	Coiled-coil

Sequence

MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
TRDLAGLRQFFKQLPSPPFLPAAGTADCR

Sequence length

269

Interactions

View interactions

	Reactome
			Interleukin-4 and Interleukin-13 signaling HCMV Late Events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (107)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17234736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17234736		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha-Thalassemia	alpha Thalassemia	BEFREE	12837581		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	12837581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21112127	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28302159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10902764	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35902923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28392644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	LHGDN	15674331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26166618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12628588, 15389879, 16322893, 18519709, 22037769, 22782348, 27181204, 30262865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22037769	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22782348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31078521	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	23247071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31078521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31078521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	21072181	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18753137	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36359732, 36675048	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21072181	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25402211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	21072181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30970615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	24222245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25884818	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	30368515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	35205232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28859294		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	30285748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	16051899		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18753137, 20971808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18753137, 20971808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31233664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23603433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21946934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	40718484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28812028, 33902539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30970615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26135629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	26135629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22440258, 27181204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22440258, 31078521, 36035213, 37059730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22440258, 27181204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31300060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31300060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37059730	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30368515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35205232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37059730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	25884818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37047552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	BEFREE	31136103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	19666867, 29120412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1391942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17234736, 20671427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	17234736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17234736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	14563831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	18753137, 26358750, 28099155, 30325409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25514196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macroprolactinoma	Macroprolactinoma	CTD_human_DG	21980073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12628588, 15389879, 16322893, 18519709, 22037769, 22782348, 27181204, 30262865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	26358750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15930295, 24810056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19690134, 20971808, 22782348, 24155666, 26314850, 27181204, 27435393, 28881585, 30325409, 31562393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18753137, 20971808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12825852, 15389879, 16322893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16322893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22396222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microprolactinoma	Microprolactinoma	CTD_human_DG	21980073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28350193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	16487687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	23247071, 30818081, 31534127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	23861541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22440258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18753137, 20385105, 20971808, 22037769, 22412049, 22782348, 23575666, 24155666, 24454781, 24810056, 26358750, 28099155, 28881585, 28910203, 30262865, 30325409, 31078521 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	20622515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31209363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23247071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	23227900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22396222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	33902539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31078521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31078521	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25409614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Opsoclonus-Myoclonus Ataxia	Opsoclonus-myoclonus syndrome	BEFREE	12837581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	12837581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	CTD_human_DG	21980073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	22635680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15930295, 24810056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15486993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	31075711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	20971808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23028973, 27813290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	24788683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	31075711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21072181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	22412049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21072181, 25402211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	10902764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32151175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	20385105, 27435393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	26307680, 27918099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18753137	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

CEBPD (CCAAT enhancer binding protein delta)