CIB1 (calcium and integrin binding 1)

Gene

• Entrez ID: 10519
• Gene name: Calcium and integrin binding 1
• Gene symbol: CIB1
• Synonyms (NCBI Gene): CIB, CIBP, EV3, KIP1, PRKDCIP, SIP2-28
• Chromosome: 15
• Chromosome location: 15q26.1
• Summary: This gene encodes a member of the EF-hand domain-containing calcium-binding superfamily. The encoded protein interacts with many other proteins, including the platelet integrin alpha-IIb-beta-3, DNA-dependent protein kinase, presenilin-2, focal adhesion k

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs143773090	G>A	Risk-factor	Non coding transcript variant, coding sequence variant, stop gained
rs1323557941	TT>-	Risk-factor	Coding sequence variant, frameshift variant, non coding transcript variant
rs1351703532	->AA	Risk-factor	Frameshift variant, non coding transcript variant, coding sequence variant
rs1567068388	->C	Risk-factor	Splice donor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029584	hsa-miR-26b-5p	Microarray	19088304
MIRT031749	hsa-miR-16-5p	Proteomics	18668040
MIRT893412	hsa-miR-1291	CLIP-seq
MIRT893413	hsa-miR-2467-5p	CLIP-seq
MIRT893414	hsa-miR-3150b-3p	CLIP-seq
MIRT893415	hsa-miR-3188	CLIP-seq
MIRT893416	hsa-miR-3908	CLIP-seq
MIRT893417	hsa-miR-3975	CLIP-seq
MIRT893418	hsa-miR-4267	CLIP-seq
MIRT893419	hsa-miR-4316	CLIP-seq
MIRT893420	hsa-miR-4519	CLIP-seq
MIRT893421	hsa-miR-4532	CLIP-seq
MIRT893422	hsa-miR-4632	CLIP-seq
MIRT893423	hsa-miR-4689	CLIP-seq
MIRT893424	hsa-miR-4710	CLIP-seq
MIRT893425	hsa-miR-4732-3p	CLIP-seq
MIRT893426	hsa-miR-4784	CLIP-seq
MIRT893427	hsa-miR-485-5p	CLIP-seq
MIRT893428	hsa-miR-549	CLIP-seq
MIRT1964820	hsa-miR-1538	CLIP-seq
MIRT1964821	hsa-miR-192	CLIP-seq
MIRT1964822	hsa-miR-215	CLIP-seq
MIRT1964823	hsa-miR-3187-3p	CLIP-seq
MIRT1964824	hsa-miR-328	CLIP-seq
MIRT1964825	hsa-miR-4435	CLIP-seq
MIRT1964826	hsa-miR-4438	CLIP-seq
MIRT1964827	hsa-miR-4453	CLIP-seq
MIRT1964828	hsa-miR-4505	CLIP-seq
MIRT1964829	hsa-miR-4538	CLIP-seq
MIRT1964830	hsa-miR-4640-5p	CLIP-seq
MIRT1964831	hsa-miR-4645-5p	CLIP-seq
MIRT1964832	hsa-miR-4673	CLIP-seq
MIRT1964833	hsa-miR-4701-5p	CLIP-seq
MIRT1964834	hsa-miR-4726-5p	CLIP-seq
MIRT1964835	hsa-miR-4745-3p	CLIP-seq
MIRT1964836	hsa-miR-548s	CLIP-seq
MIRT1964837	hsa-miR-588	CLIP-seq
MIRT893416	hsa-miR-3908	CLIP-seq
MIRT893413	hsa-miR-2467-5p	CLIP-seq
MIRT893415	hsa-miR-3188	CLIP-seq
MIRT893417	hsa-miR-3975	CLIP-seq
MIRT893419	hsa-miR-4316	CLIP-seq
MIRT893421	hsa-miR-4532	CLIP-seq
MIRT893422	hsa-miR-4632	CLIP-seq
MIRT893424	hsa-miR-4710	CLIP-seq
MIRT893427	hsa-miR-485-5p	CLIP-seq
MIRT1964820	hsa-miR-1538	CLIP-seq
MIRT1964821	hsa-miR-192	CLIP-seq
MIRT2503714	hsa-miR-214	CLIP-seq
MIRT1964822	hsa-miR-215	CLIP-seq
MIRT893413	hsa-miR-2467-5p	CLIP-seq
MIRT2503715	hsa-miR-3128	CLIP-seq
MIRT1964823	hsa-miR-3187-3p	CLIP-seq
MIRT893415	hsa-miR-3188	CLIP-seq
MIRT1964824	hsa-miR-328	CLIP-seq
MIRT2503716	hsa-miR-3619-5p	CLIP-seq
MIRT893417	hsa-miR-3975	CLIP-seq
MIRT893418	hsa-miR-4267	CLIP-seq
MIRT2503717	hsa-miR-4291	CLIP-seq
MIRT893419	hsa-miR-4316	CLIP-seq
MIRT2503718	hsa-miR-432	CLIP-seq
MIRT1964825	hsa-miR-4435	CLIP-seq
MIRT1964826	hsa-miR-4438	CLIP-seq
MIRT1964827	hsa-miR-4453	CLIP-seq
MIRT1964828	hsa-miR-4505	CLIP-seq
MIRT893421	hsa-miR-4532	CLIP-seq
MIRT1964829	hsa-miR-4538	CLIP-seq
MIRT893422	hsa-miR-4632	CLIP-seq
MIRT1964830	hsa-miR-4640-5p	CLIP-seq
MIRT1964831	hsa-miR-4645-5p	CLIP-seq
MIRT1964832	hsa-miR-4673	CLIP-seq
MIRT1964833	hsa-miR-4701-5p	CLIP-seq
MIRT893424	hsa-miR-4710	CLIP-seq
MIRT1964834	hsa-miR-4726-5p	CLIP-seq
MIRT1964835	hsa-miR-4745-3p	CLIP-seq
MIRT893427	hsa-miR-485-5p	CLIP-seq
MIRT1964836	hsa-miR-548s	CLIP-seq
MIRT893428	hsa-miR-549	CLIP-seq
MIRT1964837	hsa-miR-588	CLIP-seq
MIRT2503719	hsa-miR-761	CLIP-seq
MIRT2503720	hsa-miR-922	CLIP-seq
MIRT2503721	hsa-miR-936	CLIP-seq
MIRT1964820	hsa-miR-1538	CLIP-seq
MIRT1964821	hsa-miR-192	CLIP-seq
MIRT2503714	hsa-miR-214	CLIP-seq
MIRT1964822	hsa-miR-215	CLIP-seq
MIRT893413	hsa-miR-2467-5p	CLIP-seq
MIRT2503715	hsa-miR-3128	CLIP-seq
MIRT1964823	hsa-miR-3187-3p	CLIP-seq
MIRT893415	hsa-miR-3188	CLIP-seq
MIRT1964824	hsa-miR-328	CLIP-seq
MIRT2503716	hsa-miR-3619-5p	CLIP-seq
MIRT893417	hsa-miR-3975	CLIP-seq
MIRT893418	hsa-miR-4267	CLIP-seq
MIRT2503717	hsa-miR-4291	CLIP-seq
MIRT893419	hsa-miR-4316	CLIP-seq
MIRT2503718	hsa-miR-432	CLIP-seq
MIRT1964825	hsa-miR-4435	CLIP-seq
MIRT1964826	hsa-miR-4438	CLIP-seq
MIRT1964827	hsa-miR-4453	CLIP-seq
MIRT1964828	hsa-miR-4505	CLIP-seq
MIRT2678205	hsa-miR-4520a-3p	CLIP-seq
MIRT2678206	hsa-miR-4520b-3p	CLIP-seq
MIRT893421	hsa-miR-4532	CLIP-seq
MIRT1964829	hsa-miR-4538	CLIP-seq
MIRT893422	hsa-miR-4632	CLIP-seq
MIRT1964830	hsa-miR-4640-5p	CLIP-seq
MIRT1964831	hsa-miR-4645-5p	CLIP-seq
MIRT1964832	hsa-miR-4673	CLIP-seq
MIRT1964833	hsa-miR-4701-5p	CLIP-seq
MIRT893424	hsa-miR-4710	CLIP-seq
MIRT1964834	hsa-miR-4726-5p	CLIP-seq
MIRT1964835	hsa-miR-4745-3p	CLIP-seq
MIRT893427	hsa-miR-485-5p	CLIP-seq
MIRT1964836	hsa-miR-548s	CLIP-seq
MIRT893428	hsa-miR-549	CLIP-seq
MIRT1964837	hsa-miR-588	CLIP-seq
MIRT2503719	hsa-miR-761	CLIP-seq
MIRT2503720	hsa-miR-922	CLIP-seq
MIRT2503721	hsa-miR-936	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000287	Function	Magnesium ion binding	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001933	Process	Negative regulation of protein phosphorylation	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	ISS
GO:0002931	Process	Response to ischemia	IEA
GO:0002931	Process	Response to ischemia	ISS
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	IMP	15475008
GO:0005515	Function	Protein binding	IPI	10366599, 12011095, 15685448, 16582881, 19805025, 19854831, 20639889, 20951827, 21215777, 21264284, 22779914, 24011356, 30068544, 32296183, 32814053, 32917726
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11756406, 30068544
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IMP	10366599
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11756406, 19854831, 20639889, 21215777
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	10366599
GO:0005783	Component	Endoplasmic reticulum	IMP	10366599
GO:0005794	Component	Golgi apparatus	IEA
GO:0005813	Component	Centrosome	IDA	20951827
GO:0005813	Component	Centrosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	19854831, 20473878
GO:0005886	Component	Plasma membrane	IEA
GO:0006302	Process	Double-strand break repair	TAS	9372844
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	10366599
GO:0006974	Process	DNA damage response	IDA	12011095
GO:0007026	Process	Negative regulation of microtubule depolymerization	IDA	21215777
GO:0007113	Process	Endomitotic cell cycle	IDA	21264284
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	9030514
GO:0007283	Process	Spermatogenesis	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0007286	Process	Spermatid development	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	21264284
GO:0008427	Function	Calcium-dependent protein kinase inhibitor activity	IMP	20473878
GO:0010977	Process	Negative regulation of neuron projection development	IDA	21215777
GO:0016020	Component	Membrane	IDA	10366599
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030027	Component	Lamellipodium	IDA	21215777
GO:0030027	Component	Lamellipodium	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030220	Process	Platelet formation	IEA
GO:0030220	Process	Platelet formation	ISS
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	20473878
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030307	Process	Positive regulation of cell growth	ISS
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	ISS
GO:0030424	Component	Axon	IBA
GO:0030426	Component	Growth cone	IDA	21215777
GO:0030426	Component	Growth cone	IEA
GO:0031122	Process	Cytoplasmic microtubule organization	IMP	20951827
GO:0031267	Function	Small GTPase binding	IPI	11756406
GO:0031982	Component	Vesicle	HDA	19190083
GO:0032433	Component	Filopodium tip	IDA	20951827
GO:0032433	Component	Filopodium tip	IEA
GO:0032587	Component	Ruffle membrane	IEA
GO:0033630	Process	Positive regulation of cell adhesion mediated by integrin	IDA	11756406
GO:0038163	Process	Thrombopoietin-mediated signaling pathway	IEA
GO:0038163	Process	Thrombopoietin-mediated signaling pathway	ISS
GO:0042127	Process	Regulation of cell population proliferation	IMP	20951827
GO:0042383	Component	Sarcolemma	IBA
GO:0042383	Component	Sarcolemma	IDA	20639889
GO:0042383	Component	Sarcolemma	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IDA	21215777
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IDA	21215777
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	19854831
GO:0043085	Process	Positive regulation of catalytic activity	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043495	Function	Protein-membrane adaptor activity	IBA
GO:0043495	Function	Protein-membrane adaptor activity	IEA
GO:0043495	Function	Protein-membrane adaptor activity	IGI	20639889
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0045653	Process	Negative regulation of megakaryocyte differentiation	IEA
GO:0045653	Process	Negative regulation of megakaryocyte differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	11756406
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	19854831
GO:0051301	Process	Cell division	IEA
GO:0051302	Process	Regulation of cell division	IMP	20951827
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IBA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IDA	20639889
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IEA
GO:0071356	Process	Cellular response to tumor necrosis factor	IMP	19854831
GO:0071363	Process	Cellular response to growth factor stimulus	IBA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	ISS
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	ISS
GO:0071944	Component	Cell periphery	IDA	11756406, 20951827
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	ISS
GO:0090314	Process	Positive regulation of protein targeting to membrane	IMP	19854831
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	19805025
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IDA	11756406
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IBA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IGI	20639889
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IDA	21215777
GO:2000256	Process	Positive regulation of male germ cell proliferation	IEA
GO:2000256	Process	Positive regulation of male germ cell proliferation	ISS

Other IDs

• MIM: 602293
• HGNC: 16920
• e!Ensembl: ENSG00000185043

Protein

• UniProt ID: Q99828
• Protein name: Calcium and integrin-binding protein 1 (CIB) (Calcium- and integrin-binding protein) (CIBP) (Calmyrin) (DNA-PKcs-interacting protein) (Kinase-interacting protein) (KIP) (SNK-interacting protein 2-28) (SIP2-28)
• Protein function: Calcium-binding protein that plays a role in the regulation of numerous cellular processes, such as cell differentiation, cell division, cell proliferation, cell migration, thrombosis, angiogenesis, cardiac hypertrophy and apoptosis. Involved in
• PDB: 1DGU, 1DGV, 1XO5, 1Y1A, 2L4H, 2L4I, 2LM5, 6OCX, 6OD0
• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Expressed in the epidermis, hair follicles and keratinocytes (PubMed:30068544). Detected in platelets and in cell lines of megakaryocytic and erythrocytic lineages. Both isoform 1 and isoform 2 are detected in v
• Sequence:

  MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPQEQRSVESSLRAQVPFEQILS
  LPELKANPFKERICRVFSTSPAKDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDD
  GTLNREDLSRLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRS
  PDFASSFKIVL

• Sequence length: 191

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Epidermodysplasia verruciformis, susceptibility to, 3	Likely pathogenic; Pathogenic	rs914933274, rs143773090	RCV003990538 RCV000735848	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CIB1-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPIDERMODYSPLASIA VERRUCIFORMIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	20530095		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	8605354, 8640833		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15936816		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12670508, 15014027, 18172308, 20059402		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11557114, 21285982		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	25053516		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	12210483, 18415709, 9927492		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19318494, 26695862		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	18317952		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8640833		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	11522621		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	14500378, 19147535		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11042529, 16601696		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15685448	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	10366599		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	21374699		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10603039, 18415709		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23944957		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15925990, 18345413		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28948080		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10397744, 12351407, 27153225		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	19187271		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16413663, 19955487		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	24098519		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11118465, 12082635, 12244303, 12782606, 12907598, 14654548, 14871808, 15082918, 15802279, 16035731, 16331276, 16804901, 17148774, 17465220, 18025271, 18030569, 18794148, 19720293, 20473878, 20662004, 21447726, 22199306, 23184467, 23338153, 23893766, 24277465, 25036402, 28106536, 8625318, 9815577		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20473878	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22964641	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	17464290		★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10534337, 10603039, 10623664, 16007165, 19855998, 20334896		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19955487		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11165393, 25143434, 25851349, 26430715, 26567140		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37187730	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35812454	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10329035, 24018641, 26198169, 26213845		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27118676		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	39426048	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	8640833		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14500378, 19147535		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25663461		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12040434, 12351407, 16053658, 16565223, 19187271		★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	33243782	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11408920, 11802199, 12244568, 15073847, 17086168, 17239930, 18855981, 22490519, 24151081, 24346863		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34794407	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29028109		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11920465, 17310312, 17851288, 19246164, 21981759		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 48	Deafness	BEFREE	23023331		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25409512, 27380896		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11522621, 12107101, 12351407		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	24806449		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	22199306		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11389092, 16809439, 26963853		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19855998, 20546339, 25534318		★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	ORPHANET_DG	30068544		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	30068544, 30068545, 32917957, 35154113, 36602881	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermodysplasia verruciformis	Epidermodysplasia Verruciformis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	30068545		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24018641		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16425348, 23301842		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16425348		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	24574749		★☆☆☆☆ Found in Text Mining only
Fallopian Tube Carcinoma	Fallopian Tube Carcinoma	BEFREE	17927588		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	22322669		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	17927588		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	23009113		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10603039, 10958682, 15557280, 15605273, 16554441, 17721077, 22217655, 22337773, 23339869, 23448150, 26663363		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10958682, 15557280, 15605273, 16554441, 17721077, 22217655, 22337773, 23339869, 23448150, 26663363		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23022473, 24018641, 26088461		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	14694160		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	11598173		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12586749		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29028109		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	8547659, 8640833		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	7632960		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	16582881	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	11957145		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	24178620		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	18285702		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22426400		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37187730	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	14694160		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35154113	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	37020555, 39426048	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10918213		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	11494142, 12531224, 12631617		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15746092, 15833859, 16019539, 16315255, 21593192, 24860972		★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	24178620		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15936816, 18987662, 9171997		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11042529, 16601696		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	12167427		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	10920137		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10398686, 10779646, 11521219, 12244568, 12482975, 15082532, 15457552, 16052694, 16112786, 18808421, 19533683, 19845855, 19866239, 20546333, 20589433, 21857112, 22995332, 24049181, 24802189, 24854087, 25280563		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16052694		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10398686, 12244568, 15457552, 16112786		★☆☆☆☆ Found in Text Mining only
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	BEFREE	12351407		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11494142, 12107101, 12351407, 16019539, 17464290, 19147568		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12351407		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	18363870		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17502456, 18363870		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	18363870		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	23893766		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12586749		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11118465, 12082635, 12244303, 12782606, 12907598, 14654548, 14871808, 15082918, 15802279, 15930334, 16035731, 16331276, 16804901, 17148774, 17465220, 18025271, 18030569, 18794148, 19720293, 20473878, 20662004, 21447726, 22199306, 23184467, 23338153, 23893766, 24277465, 25036402, 28106536, 8625318, 9815577		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16809439, 26963853		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	17310312		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11165393, 25143434, 25851349, 26430715, 26567140		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	12167427		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26198169, 26213845		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15572689, 17960560, 18559508, 23393547		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10827191, 10840458, 12210483, 16425184, 19176374, 19266349, 22856547, 30885218, 9815624, 9927492		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10705239, 20668328, 22343731, 31832002		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20075119		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19955487		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10699962, 10705239, 10783304, 10928132, 11237531, 12167427, 12244303, 12351407, 12417796, 12548012, 12869921, 15073847, 15925990, 16022660, 16035731, 16437650, 16489017, 16526056, 16804901, 17178856, 17310312, 17464290, 17721077, 18363870, 18620845, 18691549, 18794148, 18941537, 19056892, 19528460, 19866239, 20197382, 20508912, 20530095, 21087931, 21935931, 21981759, 22158033, 22161326, 22199306, 22426400, 22823061, 22964641, 23251408, 23503467, 23792459, 24100703, 24583340, 25053516, 25143434, 25143484, 25826661, 26963853, 27118676, 27941888, 28317869, 29017172, 7757974, 9815577		★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	15715079		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24457952		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	11598173, 12351407, 17502456, 24178620		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	11598173		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14500378, 19147535		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11602203, 16924241, 19126397		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	24583340		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	11536304		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	10585280		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	15936816		★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11598173		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	18317952, 20833334, 24532476		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	17519308, 19318494, 19407509, 20616437, 21441703		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia type 4	Multiple Endocrine Neoplasia	BEFREE	20530095		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia, Type IV	Multiple Endocrine Neoplasia	BEFREE	20530095		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12576455, 20930946, 23893766		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	15936816, 9171997		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12456669, 15833859, 24098519		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10397272, 10446997, 10534337, 10580149, 10623664, 10699962, 10918213, 11094075, 11141482, 11237531, 11307151, 11536304, 11726500, 11920465, 11943705, 12006546, 12040434, 12073046, 12107101, 12210483, 12244303, 12351407, 12520353, 12531224, 12595890, 14871808, 15014027, 15390183, 15715079, 15802279, 15930334, 15936816, 15978859, 16019539, 16121348, 16144944, 16425348, 16574813, 16690864, 17030811, 17072952, 17178856, 17310312, 17493032, 17519308, 17569667, 17631145, 17851288, 17914096, 17951406, 18069898, 18246048, 18413741, 19056888, 19130492, 19147535, 19351827, 19528460, 19667180, 19866239, 19887899, 19924135, 20146005, 20190804, 20197382, 20407011, 20541486, 20668328, 21393859, 21563217, 21857112, 21935931, 22108090, 22199306, 22490519, 22911754, 23050025, 23172669, 23637992, 24031087, 24100703, 24151081, 24643689, 25141924, 25808857, 25851349, 26105795, 26109559, 26391562, 29017172, 30992462, 31728272, 7795247, 8605354, 8631006, 8640833, 9467944, 9815577, 9815624, 9927492		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11307151, 14691455, 15390183, 16928812, 22508481, 22964641, 23440295, 25960164, 8630967		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	15715079		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	15715079		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11141482, 11267976, 11557117, 16988944, 17456787, 21706050, 22925699, 23584484, 24041868, 25143434, 8631006		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	17316413		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	23023331, 29255404		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	10603039, 20062078		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16314512, 30992462		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	10329035, 11751512, 26198169, 26213845		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15572689, 17960560, 18559508, 23393547		★☆☆☆☆ Found in Text Mining only
Pancreatic Endocrine Carcinoma	Pancreatic Endocrine Carcinoma	BEFREE	21441703		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	25677816		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17685465, 24643689		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	23715670		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	20616437		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28939911		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	18317952		★☆☆☆☆ Found in Text Mining only
PITUITARY ADENOMA, FAMILIAL ISOLATED (disorder)	Pituitary adenoma	BEFREE	20530095		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30293818		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	8605354		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	24741631		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	11522621		★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	9328342		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	19318494, 21441703		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10827191, 10840458, 11536304, 12210483, 16425184, 17569667, 19176374, 19266349, 22856547, 30885218, 9815624, 9927492		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	18691549		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	10827191, 19266349, 9815624		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	18334831		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	17310312		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11920465, 17310312, 17851288, 19246164, 26944622		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12040434, 15746092, 16012758, 17148439, 17456787, 17951406, 20175458, 21403466		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24812285		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15652749		★☆☆☆☆ Found in Text Mining only
Seborrheic dermatitis	Seborrheic dermatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	23009113		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10918213		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16410797		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	12351407		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11585732, 12670508, 18620845		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27292876		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10705239, 20668328, 22343731, 31832002		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	11251953		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia 1	Thrombocytopenia	Pubtator	25200405	Associate	★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	25200405		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	35955827	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17914108, 20075119		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20075119		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25132260, 26105795, 30740034		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	17927973		★☆☆☆☆ Found in Text Mining only
Usher Syndrome	Usher Syndrome	BEFREE	23023331		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22653968		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19667240		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	15526363		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	10603039, 20062078		★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	25200405		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	26213845		★☆☆☆☆ Found in Text Mining only