MYBBP1A (MYB binding protein 1a)

Gene

• Entrez ID: 10514
• Gene name: MYB binding protein 1a
• Gene symbol: MYBBP1A
• Synonyms (NCBI Gene): P160, PAP2, Pol5
• Chromosome: 17
• Chromosome location: 17p13.2
• Summary: This gene encodes a nucleolar transcriptional regulator that was first identified by its ability to bind specifically to the Myb proto-oncogene protein. The encoded protein is thought to play a role in many cellular processes including response to nucleol

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027438	hsa-miR-98-5p	Microarray	19088304
MIRT029101	hsa-miR-26b-5p	Microarray	19088304
MIRT049640	hsa-miR-92a-3p	CLASH	23622248
MIRT047122	hsa-miR-183-5p	CLASH	23622248
MIRT043518	hsa-miR-331-3p	CLASH	23622248
MIRT041453	hsa-miR-193b-3p	CLASH	23622248
MIRT041453	hsa-miR-193b-3p	CLASH	23622248
MIRT038652	hsa-miR-30b-3p	CLASH	23622248
MIRT496504	hsa-miR-3186-5p	PAR-CLIP	22291592
MIRT496504	hsa-miR-3186-5p	PAR-CLIP	22291592
MIRT1167466	hsa-miR-1184	CLIP-seq
MIRT1167467	hsa-miR-1228	CLIP-seq
MIRT1167468	hsa-miR-1291	CLIP-seq
MIRT1167469	hsa-miR-3130-3p	CLIP-seq
MIRT1167470	hsa-miR-3150a-3p	CLIP-seq
MIRT1167471	hsa-miR-3175	CLIP-seq
MIRT1167472	hsa-miR-3620	CLIP-seq
MIRT1167473	hsa-miR-3649	CLIP-seq
MIRT1167474	hsa-miR-4254	CLIP-seq
MIRT1167475	hsa-miR-4292	CLIP-seq
MIRT1167476	hsa-miR-4308	CLIP-seq
MIRT1167477	hsa-miR-4651	CLIP-seq
MIRT1167478	hsa-miR-4655-5p	CLIP-seq
MIRT1167479	hsa-miR-4690-3p	CLIP-seq
MIRT1167480	hsa-miR-4763-5p	CLIP-seq
MIRT1167481	hsa-miR-4787-5p	CLIP-seq
MIRT1167482	hsa-miR-4793-3p	CLIP-seq
MIRT1167483	hsa-miR-491-5p	CLIP-seq
MIRT1167484	hsa-miR-593	CLIP-seq
MIRT1167485	hsa-miR-608	CLIP-seq
MIRT1167486	hsa-miR-885-3p	CLIP-seq
MIRT1167487	hsa-miR-939	CLIP-seq
MIRT1167468	hsa-miR-1291	CLIP-seq
MIRT2048360	hsa-miR-328	CLIP-seq
MIRT1167474	hsa-miR-4254	CLIP-seq
MIRT1167476	hsa-miR-4308	CLIP-seq
MIRT1167469	hsa-miR-3130-3p	CLIP-seq
MIRT2277212	hsa-miR-4714-3p	CLIP-seq
MIRT2277213	hsa-miR-767-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005634	Component	Nucleus	IDA	21471221
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	21471221
GO:0005730	Component	Nucleolus	IEA
GO:0005730	Component	Nucleolus	ISS
GO:0005730	Component	Nucleolus	NAS	23555303
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006338	Process	Chromatin remodeling	NAS	12769854
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	10644447
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0022904	Process	Respiratory electron transport chain	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0042149	Process	Cellular response to glucose starvation	IDA	21471221
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042564	Component	NLS-dependent protein nuclear import complex	IEA
GO:0042564	Component	NLS-dependent protein nuclear import complex	ISS
GO:0043565	Function	Sequence-specific DNA binding	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	NAS	23555303
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	26044184
GO:0045945	Process	Positive regulation of transcription by RNA polymerase III	IDA	16603771
GO:0048511	Process	Rhythmic process	IEA
GO:0070888	Function	E-box binding	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IMP	21471221
GO:0110016	Component	B-WICH complex	IDA	16603771
GO:1903450	Process	Regulation of G1 to G0 transition	IMP	21471221
GO:2000210	Process	Positive regulation of anoikis	IMP	23388179

Other IDs

• MIM: 604885
• HGNC: 7546
• e!Ensembl: ENSG00000132382

Protein

• UniProt ID: Q9BQG0
• Protein name: Myb-binding protein 1A
• Protein function: May activate or repress transcription via interactions with sequence specific DNA-binding proteins (By similarity). Repression may be mediated at least in part by histone deacetylase activity (HDAC activity) (By similarity). Acts as a corepresso
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04931	DNA_pol_phi	72 → 836	DNA polymerase phi	Family

• Sequence:

  MESRDPAQPMSPGEATQSGARPADRYGLLKHSREFLDFFWDIAKPEQETRLAATEKLLEY
  LRGRPKGSEMKYALKRLITGLGVGRETARPCYSLALAQLLQSFEDLPLCSILQQIQEKYD
  LHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKA
  LVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVGSVNLFS
  DENVPRLVNVLKMAASSVKKDRKLPAIALDLLRLALKEDKFPRFWKEVVEQGLLKMQFWP
  ASYLCFRLLGAALPLLTKEQLHLVMQGDVIRHYGEHVCTAKLPKQFKFAPEMDDYVGTFL
  EGCQDDPERQLAVLVAFSSVTNQGLPVTPTFWRVVRFLSPPALQGYVAWLRAMFLQPDLD
  SLVDFSTNNQKKAQDSSLHMPERAVFRLRKWIIFRLVSIVDSLHLEMEEALTEQVARFCL
  FHSFFVTKKPTSQIPETKHPFSFPLENQAREAVSSAFFSLLQTLSTQFKQAPGQTQGGQP
  WTYHLVQFADLLLNHSHNVTTVTPFTAQQRQAWDRMLQTLKELEAHSAEARAAAFQHLLL
  LVGIHLLKSPAESCDLLGDIQTCIRKSLGEKPRRSRTKTIDPQEPPWVEVLVEILLALLA
  QPSHLMRQVARSVFGHICSHLTPRALQLILDVLNPETSEDENDRVVVTDDSDERRLKGAE
  DKSEEGEDNRSSESEEESEGEESEEEERDGDVDQGFREQLMTVLQAGKALGGEDSENEEE
  LGDEAMMALDQSLASLFAEQKLRIQARRDEKNKLQKEKALRRDFQIRVLDLVEVLVTKQP
  ENALVLELLEPLLSIIRRSLRSSSSKQEQDLLHKTARIFTHHLCRARRYCHDLGERAGAL
  HAQVERLVQQAGRQPDSPTALYHFNASLYLLRVLKGNTAEGCVHETQEKQKAGTDPSHMP
  TGPQAASCLDLNLVTRVYSTALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHI
  TGPVRPRHQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQ
  QALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMK
  TLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAAT
  GGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQ
  VNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKA
  QVRKAGKP

• Sequence length: 1328

Pathways

Reactome:

B-WICH complex positively regulates rRNA expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Autism	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere disease	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	15919721		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11136970, 12964942, 15169882, 15917309, 18827493, 19095746, 19418218, 21059860, 22035181, 23388179, 28157321, 7542253		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19095746, 22002538	Associate	★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	12382018		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	39465737	Associate	★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	24483153		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	25543088		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19095746	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31109829		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	25543088		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11136970, 12964942, 15169882, 15917309, 18827493, 19095746, 19418218, 21059860, 22035181, 23388179, 28157321, 7542253		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30781655, 31066170		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15919721, 23559371		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23388179, 23559371, 25064129, 30781655		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18059336		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21059860		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	1700761, 22339894, 23056166, 23388179, 25064129, 25543088, 29547267, 30781655, 31066170, 31413149		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29547267		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28574850		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	28574850	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15919721, 23559371		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23559371, 38305916	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Refractory anemias	Anemia	BEFREE	14535629		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30781655, 31066170		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14535629		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	25543088		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22339894		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	28574850	Associate	★☆☆☆☆ Found in Text Mining only