CEBPB (CCAAT enhancer binding protein beta)

Gene

• Entrez ID: 1051
• Gene name: CCAAT enhancer binding protein beta
• Gene symbol: CEBPB
• Synonyms (NCBI Gene): C/EBP-beta, IL6DBP, NF-IL6, TCF5
• Chromosome: 20
• Chromosome location: 20q13.13
• Summary: This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of t

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	18367535
MIRT001560	hsa-miR-155-5p	Review	20029422
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	20427544
MIRT001560	hsa-miR-155-5p	pSILAC	18668040
MIRT001560	hsa-miR-155-5p	Microarray, qRT-PCR, Western blot	19193853
MIRT005723	hsa-miR-34a-5p	Luciferase reporter assay	20598588
MIRT006090	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006090	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	19596814
MIRT001560	hsa-miR-155-5p	ELISA, Immunoblot, Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR	19887047
MIRT006090	hsa-miR-663a	Microarray, qRT-PCR	21378144
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT006133	kshv-miR-K12-11-3p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR	21813606
MIRT001560	hsa-miR-155-5p	Luciferase reporter assay	19596814
MIRT001560	hsa-miR-155-5p	ELISA, Immunoblot, Immunocytochemistry, Immunofluorescence, Luciferase reporter assay, qRT-PCR	19887047
MIRT016122	hsa-miR-421	Sequencing	20371350
MIRT001560	hsa-miR-155-5p	Proteomics	18668040
MIRT005723	hsa-miR-34a-5p	Reporter assay	20598588
MIRT038165	hsa-miR-423-5p	CLASH	23622248
MIRT001560	hsa-miR-155-5p	Western blot	23749759
MIRT001560	hsa-miR-155-5p	Chip, ELISA, Luciferase reporter assay, QRTPCR, Western blot	23612310
MIRT437806	hsa-let-7c-5p	Luciferase reporter assay	23667114
MIRT296299	hsa-miR-374a-5p	Luciferase reporter assay	23468252
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25094047
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25094047
MIRT202310	hsa-miR-548n	PAR-CLIP	20371350
MIRT202317	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT202311	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT202308	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT235776	hsa-miR-4255	PAR-CLIP	20371350
MIRT202313	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT564030	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT564029	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT564028	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT564027	hsa-miR-371a-5p	PAR-CLIP	20371350
MIRT564026	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT154323	hsa-miR-2116-5p	PAR-CLIP	20371350
MIRT564025	hsa-miR-22-5p	PAR-CLIP	20371350
MIRT564024	hsa-miR-4477a	PAR-CLIP	20371350
MIRT564023	hsa-miR-513c-5p	PAR-CLIP	20371350
MIRT564022	hsa-miR-514b-5p	PAR-CLIP	20371350
MIRT407003	hsa-miR-4677-5p	PAR-CLIP	20371350
MIRT001560	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT001560	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT154313	hsa-miR-191-5p	Luciferase reporter assay, qRT-PCR, Western blot	25784653
MIRT038165	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT038165	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT038165	hsa-miR-423-5p	PAR-CLIP	26701625
MIRT736781	hsa-miR-155-3p	qRT-PCR	32366887
MIRT736781	hsa-miR-155-3p	Western blotting, qRT-PCR	32481686
MIRT202310	hsa-miR-548n	PAR-CLIP	20371350
MIRT202317	hsa-miR-548az-5p	PAR-CLIP	20371350
MIRT202311	hsa-miR-548t-5p	PAR-CLIP	20371350
MIRT202308	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT235776	hsa-miR-4255	PAR-CLIP	20371350
MIRT202313	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT564030	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT564029	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT564028	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT564027	hsa-miR-371a-5p	PAR-CLIP	20371350
MIRT564026	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT154323	hsa-miR-2116-5p	PAR-CLIP	20371350
MIRT564025	hsa-miR-22-5p	PAR-CLIP	20371350
MIRT564024	hsa-miR-4477a	PAR-CLIP	20371350
MIRT564023	hsa-miR-513c-5p	PAR-CLIP	20371350
MIRT564022	hsa-miR-514b-5p	PAR-CLIP	20371350
MIRT407003	hsa-miR-4677-5p	PAR-CLIP	20371350
MIRT001560	hsa-miR-155-5p	Western blotting, qRT-PCR	37505742
MIRT883257	hsa-miR-1207-5p	CLIP-seq
MIRT883258	hsa-miR-1225-3p	CLIP-seq
MIRT883259	hsa-miR-1273e	CLIP-seq
MIRT883260	hsa-miR-147b	CLIP-seq
MIRT883261	hsa-miR-1537	CLIP-seq
MIRT883262	hsa-miR-155	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883264	hsa-miR-1909	CLIP-seq
MIRT883265	hsa-miR-191	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT883267	hsa-miR-2116	CLIP-seq
MIRT883268	hsa-miR-2277-5p	CLIP-seq
MIRT883269	hsa-miR-3121-3p	CLIP-seq
MIRT883270	hsa-miR-3157-5p	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883273	hsa-miR-3189-5p	CLIP-seq
MIRT883274	hsa-miR-3191	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT883278	hsa-miR-369-3p	CLIP-seq
MIRT883279	hsa-miR-374a	CLIP-seq
MIRT883280	hsa-miR-374b	CLIP-seq
MIRT883281	hsa-miR-374c	CLIP-seq
MIRT883282	hsa-miR-376a	CLIP-seq
MIRT883283	hsa-miR-376b	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT883286	hsa-miR-4282	CLIP-seq
MIRT883287	hsa-miR-4323	CLIP-seq
MIRT883288	hsa-miR-4480	CLIP-seq
MIRT883289	hsa-miR-4520a-3p	CLIP-seq
MIRT883290	hsa-miR-4520b-3p	CLIP-seq
MIRT883291	hsa-miR-4529-3p	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883297	hsa-miR-4691-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883299	hsa-miR-4711-5p	CLIP-seq
MIRT883300	hsa-miR-4716-3p	CLIP-seq
MIRT883301	hsa-miR-4716-5p	CLIP-seq
MIRT883302	hsa-miR-4763-3p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT883306	hsa-miR-655	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883258	hsa-miR-1225-3p	CLIP-seq
MIRT883260	hsa-miR-147b	CLIP-seq
MIRT883262	hsa-miR-155	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883273	hsa-miR-3189-5p	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT883287	hsa-miR-4323	CLIP-seq
MIRT883289	hsa-miR-4520a-3p	CLIP-seq
MIRT883290	hsa-miR-4520b-3p	CLIP-seq
MIRT883291	hsa-miR-4529-3p	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT1961895	hsa-miR-561	CLIP-seq
MIRT883258	hsa-miR-1225-3p	CLIP-seq
MIRT2198457	hsa-miR-1266	CLIP-seq
MIRT883260	hsa-miR-147b	CLIP-seq
MIRT2198458	hsa-miR-1538	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT883267	hsa-miR-2116	CLIP-seq
MIRT883268	hsa-miR-2277-5p	CLIP-seq
MIRT2198459	hsa-miR-3120-3p	CLIP-seq
MIRT2198460	hsa-miR-3127-5p	CLIP-seq
MIRT883270	hsa-miR-3157-5p	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT2198461	hsa-miR-3178	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883273	hsa-miR-3189-5p	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883276	hsa-miR-3591-3p	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT2198462	hsa-miR-3660	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT2198463	hsa-miR-3914	CLIP-seq
MIRT2198464	hsa-miR-3918	CLIP-seq
MIRT2198465	hsa-miR-3940-5p	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT883287	hsa-miR-4323	CLIP-seq
MIRT2198466	hsa-miR-4503	CLIP-seq
MIRT2198467	hsa-miR-4507	CLIP-seq
MIRT2198468	hsa-miR-4518	CLIP-seq
MIRT883289	hsa-miR-4520a-3p	CLIP-seq
MIRT883290	hsa-miR-4520b-3p	CLIP-seq
MIRT2198469	hsa-miR-4526	CLIP-seq
MIRT883291	hsa-miR-4529-3p	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT2198470	hsa-miR-4645-3p	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883297	hsa-miR-4691-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT2198471	hsa-miR-4709-5p	CLIP-seq
MIRT883301	hsa-miR-4716-5p	CLIP-seq
MIRT2198472	hsa-miR-4745-3p	CLIP-seq
MIRT2198473	hsa-miR-4767	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT2198474	hsa-miR-510	CLIP-seq
MIRT2198475	hsa-miR-512-5p	CLIP-seq
MIRT2198476	hsa-miR-548t	CLIP-seq
MIRT1961895	hsa-miR-561	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT2198477	hsa-miR-935	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT2198462	hsa-miR-3660	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT2198469	hsa-miR-4526	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT2198470	hsa-miR-4645-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT2198477	hsa-miR-935	CLIP-seq
MIRT883269	hsa-miR-3121-3p	CLIP-seq
MIRT883282	hsa-miR-376a	CLIP-seq
MIRT883283	hsa-miR-376b	CLIP-seq
MIRT883261	hsa-miR-1537	CLIP-seq
MIRT883263	hsa-miR-185	CLIP-seq
MIRT883270	hsa-miR-3157-5p	CLIP-seq
MIRT883271	hsa-miR-3177-5p	CLIP-seq
MIRT883272	hsa-miR-3184	CLIP-seq
MIRT883275	hsa-miR-329	CLIP-seq
MIRT883277	hsa-miR-362-3p	CLIP-seq
MIRT883284	hsa-miR-376c	CLIP-seq
MIRT883285	hsa-miR-3941	CLIP-seq
MIRT883293	hsa-miR-4643	CLIP-seq
MIRT883294	hsa-miR-4659a-3p	CLIP-seq
MIRT883295	hsa-miR-4659b-3p	CLIP-seq
MIRT883296	hsa-miR-466	CLIP-seq
MIRT883297	hsa-miR-4691-3p	CLIP-seq
MIRT883298	hsa-miR-4707-3p	CLIP-seq
MIRT883299	hsa-miR-4711-5p	CLIP-seq
MIRT883301	hsa-miR-4716-5p	CLIP-seq
MIRT883303	hsa-miR-4778-3p	CLIP-seq
MIRT883304	hsa-miR-4789-3p	CLIP-seq
MIRT883305	hsa-miR-603	CLIP-seq
MIRT883266	hsa-miR-1910	CLIP-seq
MIRT2198465	hsa-miR-3940-5p	CLIP-seq
MIRT2198467	hsa-miR-4507	CLIP-seq
MIRT883292	hsa-miR-455-3p	CLIP-seq
MIRT2198470	hsa-miR-4645-3p	CLIP-seq
MIRT2198477	hsa-miR-935	CLIP-seq
MIRT2198459	hsa-miR-3120-3p	CLIP-seq
MIRT883269	hsa-miR-3121-3p	CLIP-seq
MIRT883278	hsa-miR-369-3p	CLIP-seq
MIRT883279	hsa-miR-374a	CLIP-seq
MIRT883280	hsa-miR-374b	CLIP-seq
MIRT883281	hsa-miR-374c	CLIP-seq
MIRT883282	hsa-miR-376a	CLIP-seq
MIRT883283	hsa-miR-376b	CLIP-seq
MIRT2198463	hsa-miR-3914	CLIP-seq
MIRT2198471	hsa-miR-4709-5p	CLIP-seq
MIRT883306	hsa-miR-655	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	16026328
ESR1	Unknown	19652226

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS	15308669
GO:0000779	Component	Condensed chromosome, centromeric region	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	30355733
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	7959007
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000979	Function	RNA polymerase II core promoter sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS	15308669
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001541	Process	Ovarian follicle development	ISS
GO:0001889	Process	Liver development	IEA
GO:0001892	Process	Embryonic placenta development	IEA
GO:0002432	Process	Granuloma formation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	10821850
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10821850
GO:0005515	Function	Protein binding	IPI	7651415, 12692227, 16227626, 17724128, 18820298, 20102225, 20111005, 20829347, 24043631, 31527615, 33961781
GO:0005634	Component	Nucleus	IDA	20829347
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8657121, 20102225, 20829347
GO:0005634	Component	Nucleus	TAS	10821850
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	20829347
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	18647749
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006953	Process	Acute-phase response	TAS	2112087
GO:0006954	Process	Inflammatory response	TAS	2112087
GO:0006955	Process	Immune response	TAS	2112087
GO:0007613	Process	Memory	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0019900	Function	Kinase binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032675	Process	Regulation of interleukin-6 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	IEA
GO:0032753	Process	Positive regulation of interleukin-4 production	ISS
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	15775988, 20829347
GO:0035035	Function	Histone acetyltransferase binding	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IEA
GO:0035711	Process	T-helper 1 cell activation	ISS
GO:0036488	Component	CHOP-C/EBP complex	IEA
GO:0036488	Component	CHOP-C/EBP complex	IPI	20102225
GO:0036488	Component	CHOP-C/EBP complex	NAS	15775988
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	ISS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044389	Function	Ubiquitin-like protein ligase binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045600	Process	Positive regulation of fat cell differentiation	IEA
GO:0045600	Process	Positive regulation of fat cell differentiation	ISS
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	IEA
GO:0045670	Process	Regulation of osteoclast differentiation	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	27812542
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27812542
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	EXP	11792321
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	7959007
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15775988
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0060644	Process	Mammary gland epithelial cell differentiation	IEA
GO:0061515	Process	Myeloid cell development	NAS	7684005
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	14685163
GO:0070169	Process	Positive regulation of biomineral tissue development	IDA	27812542
GO:0070169	Process	Positive regulation of biomineral tissue development	IMP	27812542
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0071347	Process	Cellular response to interleukin-1	IEA
GO:0072574	Process	Hepatocyte proliferation	IEA
GO:0072574	Process	Hepatocyte proliferation	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	11792321
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225
GO:0097421	Process	Liver regeneration	IEA
GO:0097421	Process	Liver regeneration	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	15762841
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1901329	Process	Regulation of odontoblast differentiation	IEA
GO:1901329	Process	Regulation of odontoblast differentiation	ISS	15308669
GO:1990647	Component	C/EBP complex	IEA
GO:1990647	Component	C/EBP complex	IPI	20102225
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000120	Process	Positive regulation of sodium-dependent phosphate transport	IDA	27812542
GO:2000120	Process	Positive regulation of sodium-dependent phosphate transport	IMP	27812542
GO:2001198	Process	Regulation of dendritic cell differentiation	IEA

Other IDs

• MIM: 189965
• HGNC: 1834
• e!Ensembl: ENSG00000172216

Protein

• UniProt ID: P17676
• Protein name: CCAAT/enhancer-binding protein beta (C/EBP beta) (Liver activator protein) (LAP) (Liver-enriched inhibitory protein) (LIP) (Nuclear factor NF-IL6) (Transcription factor 5) (TCF-5)
• Protein function: Important transcription factor regulating the expression of genes involved in immune and inflammatory responses (PubMed:12048245, PubMed:1741402, PubMed:18647749, PubMed:9374525). Also plays a significant role in adipogenesis, as well as in the
• PDB: 1GTW, 1GU4, 1GU5, 1H88, 1H89, 1H8A, 1HJB, 1IO4, 2E42, 2E43, 6MG1, 6MG2, 6MG3, 7L4V, 7UPZ, 8K8D
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07716	bZIP_2	270 → 323	Basic region leucine zipper	Coiled-coil

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low levels in the lung, kidney and spleen.
• Sequence:

  MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
  GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
  LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
  PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
  AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
  HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

• Sequence length: 345

Pathways

KEGG:

Efferocytosis
IL-17 signaling pathway
TNF signaling pathway
Tuberculosis
Transcriptional misregulation in cancer

Reactome:

Senescence-Associated Secretory Phenotype (SASP)
Transcriptional regulation of white adipocyte differentiation
Transcriptional Regulation by VENTX
Response of EIF2AK4 (GCN2) to amino acid deficiency
Response of EIF2AK1 (HRI) to heme deficiency

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS ASSOCIATED MECONIUM ILEUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CYSTIC FIBROSIS-RELATED DIABETES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, FEMALE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30135572		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	14976428		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	1730090, 24769642, 29111326		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25767874		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	30446701		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17177178		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21281310, 22818222	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	16709933		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28728847		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27659014		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31686316		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	19248099, 21917825	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21917825		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21917825	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10902764, 25811130	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30231487, 30894209	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	22818222	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31686316		★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	29111326		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	34854237	Stimulate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25266931		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	28166214, 29907633	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28392644, 29907633		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	36996081	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30376994		★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	26865646	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17394460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	32526700	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12052253, 21057224, 21098707, 23955082, 23955085, 23966000, 28810620, 30808546		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19221050, 19652226, 21057224, 21689417, 23405208, 24789216, 31019204, 33660927, 35674458	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	21447826	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23741337, 33660927, 36694148	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16709933		★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	8455626	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16026328, 28198412, 32704163	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30376994		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21150337, 25767874		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36675048	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23342250, 32593213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25402211	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	37098980	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30338905	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20460359		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20460359	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	19248099	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30607811		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35550144, 35672673	Associate	★☆☆☆☆ Found in Text Mining only
Choledochal Cyst	Cholecystolithiasis	Pubtator	36996081	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21750087		★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	24885110		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30085016		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	35484353, 36272033	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10760820, 25784653, 27433286, 29172775		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20110283, 27433286, 30658502, 33892791, 36129029, 38019240, 9374525	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31724445		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	26193632		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	LHGDN	16453302		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23342250, 29515762		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25835000, 34897030	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28166214	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27240956		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	36206743	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	22095691, 8154312		★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	21281310		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	22818222		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36281744	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20797423		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20797423, 31071302		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20460359	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20460359, 29448105		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36978091	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29589596		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	16100769	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	37717172	Associate	★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	21281310	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	21281310	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	40461968	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12713669	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	40461968	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18583320	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	37972740	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Absence	Absence epilepsy	Pubtator	32276639	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24994936		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24994936		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28148901		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	36899621	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	24469900		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibroid Tumor	Leiomyoma	LHGDN	18182446		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	20225273, 22071989		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	24265756		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22440258, 24472318, 25382637, 26267319, 27572958, 27663075, 29328002		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22440258, 27572958, 32477324, 32526700, 35836243	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22440258, 24472318, 25382637, 27572958, 27663075, 29328002		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16465418		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27572958, 27716259		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27572958, 27716259, 32477324	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	28760550	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	30389788	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	36978091	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	31415657, 33488522	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	12601168, 32460775	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	36528879, 39769352	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	LHGDN	17203171		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	37181035	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperalgesia	Hyperalgesia	Pubtator	35451875	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	21595849, 25294851		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27400471	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	37098980	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30587688	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30894209	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	34831059	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29725016, 30530690		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35212366	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17986714	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	32084215	Associate	★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	9199351		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16709933, 20015877, 21343335, 23741337		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	16709933		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25294851		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	28166214	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20948428, 29394256		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25127121, 36913305	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37554265	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1391942, 25448741	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16046262, 16418324, 24264602, 25127121, 26868909, 29966306, 33958723, 34207065, 36913305	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17854664	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	14592978, 23711709, 33901013	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25982114, 26055960, 30135572		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26193637	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	28668397		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	14563831		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14728809		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21145827, 21283634, 25965830, 28321907, 29731667, 30643190, 7680115, 8844998		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21145827, 7680115, 8844998		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	30530593, 31471107		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	30530593	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16820889		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19723873, 21150337, 24488911	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	12496392		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27659348		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12970736		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16709933	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12052253, 21057224, 21098707, 23955082, 23955085, 28810620, 30808546		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24994936		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22446383		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21150337, 25767874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31546150		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26968249, 27577074, 29322786		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30698678		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26514342		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30376994		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14728809, 19958352, 23770848, 24980078, 24994936, 25539728, 25959126, 28148901, 28321907, 29259016, 30705122, 30969151, 31042624, 31428903		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12670924, 12825852, 16959612		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32467529, 36353635	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	20460359	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	33540559	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25229239	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	32617116	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21389327	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1730090		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	31071302		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16414987, 30945396	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22440258	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10760820, 12680236, 14728809, 15805255, 21098707, 21283634, 23955085, 25382637, 27522676, 27716259, 28148901, 29169725, 29322786, 29563610, 30395963, 30482226, 31603915, 8813130		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	22818222		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	21281310		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	36674978	Associate	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	22634316		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30754676		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20460359		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20460359, 22309242	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	20460359	Associate	★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	10590092	Associate	★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	8154312		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	38554527	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28942243, 31364785		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28942243, 31364785	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10098766, 29712898, 37303939	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12713669	Stimulate	★☆☆☆☆ Found in Text Mining only
Paget Disease	Paget disease	BEFREE	8154312		★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	31408114		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31546150		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27659014		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	18682709		★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	25294851		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21281310, 22818222, 36674978	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22818222, 29051532		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	40127057	Associate	★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	22818222		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26968249, 27577074, 29322786		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18512730		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22081596, 25772238	Associate	★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	31408114		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26511475	Stimulate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17177178		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21998664, 31471107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23342250, 29515762		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29216750		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	25811130		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	28148901	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	9199351	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	15687482	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	12707271	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27430527, 28476751, 28934717, 31078118		★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	26762974		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	18216322, 25402211		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24589738, 24994936		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25229239, 35365168	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10506755		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	24469900		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25048951		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25740226, 26514342		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16414987, 16474375, 36514982, 37192160	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subfertility, Female	Subfertility	CTD_human_DG	21177758		★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	10902764	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	33599741	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	31415657		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	18682709	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	15785238, 18682709		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18682709	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29805099, 30335837, 30482226		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30335837, 33660927, 40022434	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33928605, 9499067	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36694148	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	18182446		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	40550050	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	25294851		★☆☆☆☆ Found in Text Mining only