Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10509
Gene name	Semaphorin 4B
Gene symbol	SEMA4B
Synonyms (NCBI Gene)	SEMACSemC
Chromosome	15
Chromosome location	15q26.1

158

Show/Hide all (158)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017490	hsa-miR-335-5p	Microarray	18185580
MIRT051498	hsa-let-7e-5p	CLASH	23622248
MIRT073414	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT073407	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT073414	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT073406	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT073418	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT073408	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT073423	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT073407	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT1335046	hsa-miR-106a	CLIP-seq
MIRT1335047	hsa-miR-106b	CLIP-seq
MIRT1335048	hsa-miR-1236	CLIP-seq
MIRT1335049	hsa-miR-1238	CLIP-seq
MIRT1335050	hsa-miR-125b	CLIP-seq
MIRT1335051	hsa-miR-142-5p	CLIP-seq
MIRT1335052	hsa-miR-145	CLIP-seq
MIRT1335053	hsa-miR-17	CLIP-seq
MIRT1335054	hsa-miR-20a	CLIP-seq
MIRT1335055	hsa-miR-20b	CLIP-seq
MIRT1335056	hsa-miR-216b	CLIP-seq
MIRT1335057	hsa-miR-3126-5p	CLIP-seq
MIRT1335058	hsa-miR-3140-5p	CLIP-seq
MIRT1335059	hsa-miR-3150a-3p	CLIP-seq
MIRT1335060	hsa-miR-3153	CLIP-seq
MIRT1335061	hsa-miR-3165	CLIP-seq
MIRT1335062	hsa-miR-3175	CLIP-seq
MIRT1335063	hsa-miR-3201	CLIP-seq
MIRT1335064	hsa-miR-3609	CLIP-seq
MIRT1335065	hsa-miR-3676	CLIP-seq
MIRT1335066	hsa-miR-4303	CLIP-seq
MIRT1335067	hsa-miR-4326	CLIP-seq
MIRT1335068	hsa-miR-4419a	CLIP-seq
MIRT1335069	hsa-miR-4426	CLIP-seq
MIRT1335070	hsa-miR-4452	CLIP-seq
MIRT1335071	hsa-miR-4477a	CLIP-seq
MIRT1335072	hsa-miR-4484	CLIP-seq
MIRT1335073	hsa-miR-4510	CLIP-seq
MIRT1335074	hsa-miR-4534	CLIP-seq
MIRT1335075	hsa-miR-4647	CLIP-seq
MIRT1335076	hsa-miR-4649-3p	CLIP-seq
MIRT1335077	hsa-miR-4662b	CLIP-seq
MIRT1335078	hsa-miR-4680-3p	CLIP-seq
MIRT1335079	hsa-miR-4725-5p	CLIP-seq
MIRT1335080	hsa-miR-4747-5p	CLIP-seq
MIRT1335081	hsa-miR-4751	CLIP-seq
MIRT1335082	hsa-miR-4791	CLIP-seq
MIRT1335083	hsa-miR-4796-3p	CLIP-seq
MIRT1335084	hsa-miR-504	CLIP-seq
MIRT1335085	hsa-miR-519a	CLIP-seq
MIRT1335086	hsa-miR-519b-3p	CLIP-seq
MIRT1335087	hsa-miR-519c-3p	CLIP-seq
MIRT1335088	hsa-miR-519d	CLIP-seq
MIRT1335089	hsa-miR-541	CLIP-seq
MIRT1335090	hsa-miR-548ah	CLIP-seq
MIRT1335091	hsa-miR-654-5p	CLIP-seq
MIRT1335092	hsa-miR-658	CLIP-seq
MIRT1335093	hsa-miR-670	CLIP-seq
MIRT1335094	hsa-miR-93	CLIP-seq
MIRT1335095	hsa-miR-939	CLIP-seq
MIRT2099065	hsa-miR-615-3p	CLIP-seq
MIRT1335050	hsa-miR-125b	CLIP-seq
MIRT1335057	hsa-miR-3126-5p	CLIP-seq
MIRT2099066	hsa-miR-3909	CLIP-seq
MIRT1335068	hsa-miR-4419a	CLIP-seq
MIRT2099067	hsa-miR-4436b-3p	CLIP-seq
MIRT1335073	hsa-miR-4510	CLIP-seq
MIRT2099068	hsa-miR-4685-5p	CLIP-seq
MIRT2099069	hsa-miR-4701-5p	CLIP-seq
MIRT2099070	hsa-miR-4710	CLIP-seq
MIRT2099071	hsa-miR-4786-3p	CLIP-seq
MIRT2099072	hsa-miR-544b	CLIP-seq
MIRT2099073	hsa-miR-588	CLIP-seq
MIRT1335093	hsa-miR-670	CLIP-seq
MIRT2099074	hsa-miR-885-3p	CLIP-seq
MIRT2323847	hsa-miR-1229	CLIP-seq
MIRT1335048	hsa-miR-1236	CLIP-seq
MIRT1335050	hsa-miR-125b	CLIP-seq
MIRT2323848	hsa-miR-1273	CLIP-seq
MIRT1335057	hsa-miR-3126-5p	CLIP-seq
MIRT1335058	hsa-miR-3140-5p	CLIP-seq
MIRT2323849	hsa-miR-3144-5p	CLIP-seq
MIRT1335059	hsa-miR-3150a-3p	CLIP-seq
MIRT1335062	hsa-miR-3175	CLIP-seq
MIRT2323850	hsa-miR-3179	CLIP-seq
MIRT2323851	hsa-miR-3191	CLIP-seq
MIRT2323852	hsa-miR-3199	CLIP-seq
MIRT2323853	hsa-miR-3202	CLIP-seq
MIRT2323854	hsa-miR-3545-3p	CLIP-seq
MIRT1335066	hsa-miR-4303	CLIP-seq
MIRT1335068	hsa-miR-4419a	CLIP-seq
MIRT1335070	hsa-miR-4452	CLIP-seq
MIRT2323855	hsa-miR-4476	CLIP-seq
MIRT1335073	hsa-miR-4510	CLIP-seq
MIRT2323856	hsa-miR-4515	CLIP-seq
MIRT1335074	hsa-miR-4534	CLIP-seq
MIRT1335076	hsa-miR-4649-3p	CLIP-seq
MIRT2323857	hsa-miR-4652-5p	CLIP-seq
MIRT2323858	hsa-miR-4667-5p	CLIP-seq
MIRT1335078	hsa-miR-4680-3p	CLIP-seq
MIRT2323859	hsa-miR-4688	CLIP-seq
MIRT2323860	hsa-miR-4700-5p	CLIP-seq
MIRT2099070	hsa-miR-4710	CLIP-seq
MIRT1335080	hsa-miR-4747-5p	CLIP-seq
MIRT1335081	hsa-miR-4751	CLIP-seq
MIRT2323861	hsa-miR-4802-5p	CLIP-seq
MIRT1335089	hsa-miR-541	CLIP-seq
MIRT2099072	hsa-miR-544b	CLIP-seq
MIRT2323862	hsa-miR-602	CLIP-seq
MIRT1335091	hsa-miR-654-5p	CLIP-seq
MIRT1335093	hsa-miR-670	CLIP-seq
MIRT1335095	hsa-miR-939	CLIP-seq
MIRT2099066	hsa-miR-3909	CLIP-seq
MIRT2099067	hsa-miR-4436b-3p	CLIP-seq
MIRT2099068	hsa-miR-4685-5p	CLIP-seq
MIRT2099071	hsa-miR-4786-3p	CLIP-seq
MIRT2099074	hsa-miR-885-3p	CLIP-seq
MIRT2440113	hsa-miR-31	CLIP-seq
MIRT2440114	hsa-miR-320e	CLIP-seq
MIRT2440115	hsa-miR-4438	CLIP-seq
MIRT2440116	hsa-miR-4690-3p	CLIP-seq
MIRT2440117	hsa-miR-4708-3p	CLIP-seq
MIRT2440118	hsa-miR-5095	CLIP-seq
MIRT2442612	hsa-miR-1184	CLIP-seq
MIRT2442613	hsa-miR-1205	CLIP-seq
MIRT2440113	hsa-miR-31	CLIP-seq
MIRT1335058	hsa-miR-3140-5p	CLIP-seq
MIRT2442614	hsa-miR-3158-5p	CLIP-seq
MIRT2440114	hsa-miR-320e	CLIP-seq
MIRT2440116	hsa-miR-4690-3p	CLIP-seq
MIRT2440117	hsa-miR-4708-3p	CLIP-seq
MIRT2442612	hsa-miR-1184	CLIP-seq
MIRT2442613	hsa-miR-1205	CLIP-seq
MIRT2440113	hsa-miR-31	CLIP-seq
MIRT1335058	hsa-miR-3140-5p	CLIP-seq
MIRT2442614	hsa-miR-3158-5p	CLIP-seq
MIRT2619730	hsa-miR-3190	CLIP-seq
MIRT2323853	hsa-miR-3202	CLIP-seq
MIRT2440114	hsa-miR-320e	CLIP-seq
MIRT2619731	hsa-miR-3652	CLIP-seq
MIRT2619732	hsa-miR-3978	CLIP-seq
MIRT2619733	hsa-miR-4259	CLIP-seq
MIRT2619734	hsa-miR-4430	CLIP-seq
MIRT2619735	hsa-miR-4433	CLIP-seq
MIRT2099067	hsa-miR-4436b-3p	CLIP-seq
MIRT2440115	hsa-miR-4438	CLIP-seq
MIRT2619736	hsa-miR-4491	CLIP-seq
MIRT2619737	hsa-miR-4533	CLIP-seq
MIRT2619738	hsa-miR-4657	CLIP-seq
MIRT2440116	hsa-miR-4690-3p	CLIP-seq
MIRT2440117	hsa-miR-4708-3p	CLIP-seq
MIRT2099070	hsa-miR-4710	CLIP-seq
MIRT2619739	hsa-miR-4792	CLIP-seq
MIRT2440118	hsa-miR-5095	CLIP-seq
MIRT2619740	hsa-miR-571	CLIP-seq
MIRT2619741	hsa-miR-665	CLIP-seq
MIRT2619742	hsa-miR-875-3p	CLIP-seq
MIRT2099074	hsa-miR-885-3p	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001755	Process	Neural crest cell migration	IBA
GO:0005515	Function	Protein binding	IPI	33845483, 34232536, 36217030
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	IBA
GO:0016020	Component	Membrane	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030215	Function	Semaphorin receptor binding	IBA
GO:0030215	Function	Semaphorin receptor binding	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0038191	Function	Neuropilin binding	IBA
GO:0045202	Component	Synapse	IEA
GO:0045499	Function	Chemorepellent activity	IBA
GO:0050919	Process	Negative chemotaxis	IBA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
617029	10730	ENSG00000185033

Q9NPR2

Protein name

Semaphorin-4B (Semaphorin-C)

Protein function

Inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01403	Sema	72 → 505	Sema domain	Family
PF01437	PSI	525 → 579	Plexin repeat	Family

Sequence

MLRTAMGLRSWLAAPWGALPPRPPLLLLLLLLLLLQPPPPTWALSPRISLPLGSEERPFL
RFEAEHISNYTALLLSRDGRTLYVGAREALFALSSNLSFLPGGEYQELLWGADAEKKQQC
SFKGKDPQRDCQNYIKILLPLSGSHLFTCGTAAFSPMCTYINMENFTLARDEKGNVLLED
GKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESSLNWLQDPAF
VASAYIPESLGSLQGDDDKIYFFFSETGQEFEFFENTIVSRIARICKGDEGGERVLQQRW
TSFLKAQLLCSRPDDGFPFNVLQDVFTLSPSPQDWRDTLFYGVFTSQWHRGTTEGSAVCV
FTMKDVQRVFSGLYKEVNRETQQWYTVTHPVPTPRPGACITNSARERKINSSLQLPDRVL
NFLKDHFLMDGQVRSRMLLLQPQARYQRVAVHRVPGLHHTYDVLFLGTGDGRLHKAVSVG
PRVHIIEELQIFSSGQPVQNLLLDTHRGLLYAASHSGVVQVPMANCSLYRSCGDCLLARD
PYCAWSGSSCKHVSLYQPQLATRPWIQDIEGASAKDLCSASSVVSPSFVPTGEKPCEQVQ
FQPNTVNTLACPLLSNLATRLWLRNGAPVNASASCHVLPTGDLLLVGTQQLGEFQCWSLE
EGFQQLVASYCPEVVEDGVADQTDEGGSVPVIISTSRVSAPAGGKASWGADRSYWKEFLV
MCTLFVLAVLLPVLFLLYRHRNSMKVFLKQGECASVHPKTCPVVLPPETRPLNGLGPPST
PLDHRGYQSLSDSPPGSRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV

Sequence length

837

Interactions

View interactions

	KEGG
	Axon guidance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SEBORRHEIC KERATOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne Vulgaris	Acne	GWASCAT_DG	30542056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22761399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	28850114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36115854	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17213806, 24474252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29968393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36817485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29197895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36817485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal fibrosing alopecia	Frontal Fibrosing Alopecia	GWASCAT_DG	30850646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29311693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24474252	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	28850114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24474252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36115854	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17213806, 24474252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30241953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	35802752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24474252, 25095981, 25746385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Postmenopausal frontal fibrosing alopecia	Frontal fibrosing alopecia	GWASCAT_DG	30850646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30241953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28850114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	28850114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30097497, 32481437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tendinopathy	Tendinopathy	BEFREE	29218618		★★★★★ ★☆☆☆☆ Found in Text Mining only

SEMA4B (semaphorin 4B)